KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01731Help
Entry
SAA6008_01731     CDS       T01886                                 

Definition
(GenBank) multidrug resistance transporter protein B
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ADL65763
LinkDB All DBs
Position
complement(1868602..1869783)
Genome map
AA seq 393 aa AA seqDB search
MNIPKSVWWLVIGMALNITGSSFLWPLNTIYMKQELGKSLTVAGLVLMINSFGMVIGNLL
GGSLFDKLGGYKTILIGTFTCLCSTTLLNFFHGWPWYAVWLVMLGFGGGMIIPAIYAMAG
AVWPNGGRQTFNAIYLAQNIGVAVGAAMGGFVAEFSFNYIFLANLIMYVVFALVAVTQFN
IEINAKVKYPTHLDITGKKNKARFISLVLICAMFAICWVAYIQWESTIASFTQSINISMA
QYSVLWTINGIMILVAQPLIKPILYLLKGNLKKQMFVGIIIFMLSFFVTSFAENFTIFVV
GMIILTFGEMFVWPAVPTIANQLAPDGKQGQYQGFVNSAATVGKAFGPFLGGVLVDAFNM
RMMFIGMMLLLVFALILLMVFKENNTQPKKIDA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacctaaatcagtctggtggctagtaattggcatggcgttaaatattactggt
tccagttttttgtggcctttaaatacaatttatatgaaacaagaacttggaaaaagttta
actgttgctggtttagtgctaatgataaattcatttggcatggttattggaaacttatta
ggtggttcactatttgataaattaggtggatacaagacgattttaattggaactttcact
tgtctttgtagtacaacgctacttaatttctttcacgggtggccttggtatgctgtatgg
cttgtaatgttagggtttggtggcggaatgattattcctgcgatatacgctatggctgga
gcagtgtggccaaatggcggaagacaaacgtttaatgcgatatacttagcgcaaaatatt
ggtgtggctgtcggtgctgcaatgggcggctttgtcgcagaatttagctttaactatatc
tttttagccaatcttattatgtatgttgtgtttgcgcttgtcgcggtaacgcaatttaat
attgaaattaatgcgaaagttaaatatccaactcatttagatattactggtaaaaagaat
aaagcaagatttatttcattagtactaatttgtgcaatgtttgcaatttgttgggttgca
tatattcaatgggagtctacaatcgcttcatttacacaatctattaatatttcaatggca
caatatagtgttttatggacaattaacggaataatgattttagtagcacaaccattaatt
aaaccgattctctatctgttaaaaggaaacttaaagaagcaaatgtttgtcggcatcatc
atttttatgttgtcgttctttgtcacgagttttgccgaaaactttacaatatttgttgtc
ggtatgattattttaacttttggagaaatgtttgtatggccagcagttccaactatagcc
aatcagttagcgccagatggtaagcaaggacagtaccaaggttttgtgaattcagctgct
acagtaggaaaagcatttggtccatttcttggtggtgtattagttgatgcgtttaatatg
cgcatgatgtttatcggtatgatgctactacttgtatttgcattaatattattaatggtt
ttcaaggagaataatacgcaacctaaaaaaatagatgcataa

DBGET integrated database retrieval system