KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_02160Help
Entry
SAA6008_02160     CDS       T01886                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00010  Glycolysis / Gluconeogenesis
suk00053  Ascorbate and aldarate metabolism
suk00071  Fatty acid degradation
suk00280  Valine, leucine and isoleucine degradation
suk00310  Lysine degradation
suk00330  Arginine and proline metabolism
suk00340  Histidine metabolism
suk00380  Tryptophan metabolism
suk00410  beta-Alanine metabolism
suk00561  Glycerolipid metabolism
suk00620  Pyruvate metabolism
suk00625  Chloroalkane and chloroalkene degradation
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6008_02160 (aldA)
   00053 Ascorbate and aldarate metabolism
    SAA6008_02160 (aldA)
   00620 Pyruvate metabolism
    SAA6008_02160 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAA6008_02160 (aldA)
   00561 Glycerolipid metabolism
    SAA6008_02160 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAA6008_02160 (aldA)
   00310 Lysine degradation
    SAA6008_02160 (aldA)
   00330 Arginine and proline metabolism
    SAA6008_02160 (aldA)
   00340 Histidine metabolism
    SAA6008_02160 (aldA)
   00380 Tryptophan metabolism
    SAA6008_02160 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAA6008_02160 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAA6008_02160 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAA6008_02160 (aldA)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAA6008_02160 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADL66180
LinkDB All DBs
Structure
PDB: 

Position
complement(2267938..2269365)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system