KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0420Help
Entry
SYO3AOP1_0420     CDS       T00715                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00473  D-Alanine metabolism
sul00550  Peptidoglycan biosynthesis
sul01100  Metabolic pathways
sul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SYO3AOP1_0420
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYO3AOP1_0420
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SYO3AOP1_0420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sul01011]
    SYO3AOP1_0420
Enzymes [BR:sul01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SYO3AOP1_0420
Peptidoglycan biosynthesis and degradation proteins [BR:sul01011]
 Precursor biosynthesis
  Amino acid ligase
   SYO3AOP1_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 GARS_A ATP-grasp_4 ATP-grasp RimK ATPgrasp_ST TTL VasL Synapsin_C
Motif
Other DBs
NCBI-ProteinID: ACD66063
UniProt: B2V7Z0
LinkDB All DBs
Position
435592..436491
Genome map
AA seq 299 aa AA seqDB search
MTKIALLYGGYSREREISIKSGKAVEKALNQLGYDYKVFDIIERDKFIKEILEYKPDLAF
IVLHGKGGEDGTIQAILEFLGIPYTGSDMKTSVIAMDKVLTKMYLKNFDIPTPDWIFFTE
EKEALNYRPDFPAVVKAPTEGSSIGVYIVNNQQEYENAVKEVFNLDDKVLIEKFIKGREL
TVSILDDEVFDIVEVVVSEGFYDFNNKYITGKTQYICPAQLDEDVYKNVQGLGHKVYKLL
NCKGPARVDIILENDKNPYVLEVNTIPGMTEFSLLPKAASARGITFNQLVEKIIKNSLK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaaatcgcacttttatacggtggatattcaagagaaagagagatttctatcaaa
agtggaaaagcggtagaaaaagctttaaaccaacttggatatgattataaggtatttgac
ataatagaaagagataaatttataaaagagattttagaatataagccagatttagcattt
atagttttacacggaaaaggtggagaagatggcacaattcaagctatcttagagtttctt
ggcattccttacacagggtcagatatgaaaacaagcgtcatagcaatggataaagtacta
acaaagatgtatttgaaaaactttgacattccaacgccagattggatatttttcacagaa
gaaaaagaggctttaaattatagaccagatttcccagcagtcgtaaaagctccaacagaa
gggtcttctattggtgtttatatagtaaataatcaacaagagtatgaaaatgctgtaaaa
gaagtatttaatcttgatgataaagtattgatagaaaagtttatcaaaggaagagagcta
acagttagcattcttgatgatgaagtttttgatattgttgaagttgttgtatcagaaggc
ttctatgattttaataacaaatacattacaggaaaaactcagtatatatgcccggctcaa
ttagatgaagatgtgtataaaaacgttcaaggtttaggacataaagtttataaacttttg
aattgcaaaggacctgcaagagttgatatcattttagaaaacgataagaatccatatgtg
ttggaagtaaatacaatccccggaatgacagagtttagtcttcttcccaaggctgcatcg
gcaagaggaataacgtttaaccaacttgtagaaaaaataataaaaaatagtttaaaatga

DBGET integrated database retrieval system