KEGG   Sulfolobus sp. A20: BFU36_05105Help
Entry
BFU36_05105       CDS       T04516                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sula  Sulfolobus sp. A20
Pathway
sula03030  DNA replication
sula03410  Base excision repair
sula03420  Nucleotide excision repair
sula03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sula00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BFU36_05105
   03410 Base excision repair
    BFU36_05105
   03420 Nucleotide excision repair
    BFU36_05105
   03430 Mismatch repair
    BFU36_05105
Enzymes [BR:sula01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BFU36_05105
    6.5.1.6  DNA ligase (ATP or NAD+)
     BFU36_05105
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BFU36_05105
DNA replication proteins [BR:sula03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BFU36_05105
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BFU36_05105
DNA repair and recombination proteins [BR:sula03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BFU36_05105
   NER (nucleotide excision repair)
    Other NER factors
     BFU36_05105
   MMR (mismatch exicision repair)
    Other MMR factors
     BFU36_05105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Spore_Cse60 CheY-binding
Motif
Other DBs
NCBI-ProteinID: AOL16192
UniProt: A0A1C8ZS26
LinkDB All DBs
Position
complement(920264..922078)
Genome map
AA seq 604 aa AA seqDB search
MQFKVIADYFDKLEKISSRLQLTALLSDLLSKADKENVDKVIYIIQGKLWPDFLGYPELG
IGEKFLIKAISIATNVKESEVEGLNKKLGDLGEVARMLKSKQQSSSILSFLNTGKTDEGL
SLEETYSTLSKIALTTGEGSRDLKIRLLAGLLKKADPLEAKFLVRFVEGRLRVGIGDATI
IDALAIAFGGGQNNSEIIERAYNVRADLGNIAKILMENGIEALKTVKPEAGIPIRPMLAE
RLSDPEEILKKVGGLALVDYKYDGERAQIHKDGNKIYIFSRRLENITSQYPDVVDYISEF
IDGDKFIIEGEIVAIDPESGEIRPFQELMHRKRKSDIHEAIKSYPVNVFLFDLMLYNDED
YTNRPLQDRRKILEAIVKNNDKVKIANHIMTDNVNVLKQFFYQAISDGTEGVMVKSLSKD
SIYQAGARGWLWIKLKRDYQSEMADTVDLVVIGGFYGKGKRGGKLSSLLMAAYNPSTDTF
DSVCKVASGFSDEQLDDLQKKLNEIKRQTKHPRVNSKMEPDVWVEPLYVAEIIGAEITLS
PLHSCCQDMIAKDSGLSIRFPRFIRWREDKGPEDATTTEEILEMYKRQLKKKVDTSQSEE
NANI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttaaagttatcgcagattattttgacaaattggaaaaaatttcctcaagattg
caattaacggccttactctctgatctgttaagcaaggctgacaaggaaaacgtagacaaa
gtaatttatattatccaaggaaaattatggccagacttcttgggttatccagaattaggt
attggagagaaattccttattaaggcaatcagtatagctactaatgttaaagagagtgaa
gtagaaggtttaaacaaaaagttaggagatcttggagaagtagctagaatgttaaagagt
aaacaacaatcctcttcaattttaagttttctgaatactggtaaaactgatgaaggattg
agtctagaagaaacttactctacgctaagtaagatagcattaacaactggcgaaggcagt
agagatttaaaaattaggttactggctggattgctaaaaaaggcagatccactagaagct
aaattcttagtaagattcgttgaaggcagactaagagttggaataggtgatgcaacaatt
atagatgctttagctattgcatttggaggtgggcaaaataattcagaaataatagaaaga
gcatataacgttagagctgacctaggtaacattgcaaaaattctaatggaaaacggcatt
gaagcattaaaaactgtcaagcctgaggcaggaattcctattagaccaatgttagcagaa
aggctctcagatccagaggaaatattgaaaaaagttggtggtttagccttagttgactat
aaatatgatggggaaagagctcaaatacacaaggatgggaataaaatctatatcttttcc
agaagattagaaaacataacctcacagtacccagatgtcgtagattacattagtgagttt
atagatggagacaagttcataattgagggtgagattgtagctatagatccagagagtgga
gaaattagaccatttcaagagctaatgcatagaaagagaaaatctgatattcatgaagct
attaagagttacccggttaacgtgtttttatttgacctaatgctatataacgacgaagat
tatactaatagacctttgcaagatcgaaggaaaattttagaagctattgtaaaaaataat
gataaagtaaaaatagctaaccatatcatgacggataatgtaaatgtattgaaacaattc
ttttatcaagcaatatctgatggaacagaaggggtgatggttaaatccttaagtaaagat
tcgatttatcaagctggagctagaggatggctatggataaagttaaagcgtgactaccag
agtgaaatggctgacacggtagatttagtagtaataggaggtttctacggaaaaggcaaa
agaggtggaaaattaagttcattattgatggcagcttacaatccatccactgatactttt
gattcagtatgcaaggtagctagtggattctctgatgaacaactagatgatttacaaaag
aaattgaatgagataaagaggcaaaccaaacatcctagagtaaattctaaaatggagcct
gacgtgtgggtagagccattatatgtagcggaaataataggtgccgagataacactctct
cccttacattcatgttgccaagatatgatagctaaagattctggattatcaatcagattt
cctagattcataagatggagagaagataaaggtccagaggatgctactacaactgaagag
atcttagagatgtataagagacagttaaagaaaaaggtagatactagccagtcagaagaa
aacgctaatatttaa

DBGET integrated database retrieval system