KEGG   Sulfitobacter sp. D7: B5M07_00260Help
Entry
B5M07_00260       CDS       T05714                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00220  Arginine biosynthesis
suld01100  Metabolic pathways
suld01110  Biosynthesis of secondary metabolites
suld01130  Biosynthesis of antibiotics
suld01210  2-Oxocarboxylic acid metabolism
suld01230  Biosynthesis of amino acids
Module
suld_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B5M07_00260
Enzymes [BR:suld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     B5M07_00260
    2.3.1.35  glutamate N-acetyltransferase
     B5M07_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ Myco_19_kDa
Motif
Other DBs
NCBI-ProteinID: AYE84668
UniProt: A0A386TA67
LinkDB All DBs
Position
68128..69354
Genome map
AA seq 408 aa AA seqDB search
MGKSLAVSPLAPARFPDLPVIDGVTFATIAAGVRYQGRTDVMLAKLAPGSAVAGAFTRSA
TRAAPVLDCQAKIGGASDEGAAIVVNSGNANAFTGRGGTDAVEAITAAAAEACGVPQSRV
FTSSTGVIGEPLPHERITAVLGDLHAKLDPAGIEDAARAIMTTDTFPKGASATVEIDGKT
VSIAGIAKGSGMIAPDMATMLVYIFTDAVIATDALQHRLSTHTETTFNCITVDSDTSTSD
ALIMAATGASGVEVADNEAFDAALRDVMMDLAHQVVKDGEGAQKFVEVAVTGASNDDEAK
VHAMAIANSPLIKTAIAGEDPNWGRVVMAIGKSGAPADRDRLSIRFGDIEVARDGWRSPD
YSEEDAAAHMKGQNVVIGVDLGLGEGRCTVWTCDLTHGYIDINADYRS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatcactggctgtctcgccgctcgccccggcccgttttcccgaccttccggtt
attgacggcgtgacattcgccaccatcgctgctggcgtccgctatcaagggcgcaccgat
gtgatgttggcgaagctggcaccgggcagtgctgtggcgggggcgttcacacgctctgcc
acccgcgcggccccggtgctggactgccaggcaaaaatcggcggtgcctcggatgagggc
gccgccatcgtcgtgaactccggcaatgccaacgcctttaccgggcggggcggcaccgac
gcggtcgaggcgattaccgccgccgccgccgaagcctgcggcgtgccgcaatcgcgggtt
ttcacgtcgtccaccggcgtcatcggcgaacccctgccccacgaacggatcaccgccgtg
ctgggcgatctccacgcaaaactcgaccctgccggcatcgaagacgccgcgcgggccatc
atgacaacggatactttccccaaaggcgccagcgcgaccgtagagatcgacggcaaaacc
gtctctattgcggggatcgccaaaggctcgggcatgatcgcgcccgatatggccaccatg
ctggtctatatctttaccgatgcggtaatcgcgacagatgcgctgcaacaccgcctttcg
acccataccgagacgacattcaactgcatcaccgtcgacagcgatacctcaacctctgac
gcgctgatcatggccgcgacgggggcctccggggtcgaggtcgctgacaacgaagccttc
gacgcggcgctgcgtgacgtgatgatggaccttgcacatcaggtcgtcaaagacggcgaa
ggcgcgcagaaattcgtcgaagtggccgtcaccggtgcctccaacgatgacgaggccaag
gtccacgccatggccatcgccaattcgccgctgatcaaaaccgccattgctggtgaagac
cccaactggggccgcgtcgtcatggccatcgggaaatcaggcgctccggcagaccgcgac
cgcctgtcgatccgctttggggatatcgaagtcgcccgcgacggctggcgcagccccgac
tattccgaagaggatgccgccgcccatatgaagggccagaatgtcgtcatcggcgttgat
ctgggcctcggcgaaggccgctgcaccgtctggacctgtgaccttacccacggctacatc
gacatcaacgccgactaccggtcctga

DBGET integrated database retrieval system