KEGG   Sulfitobacter sp. D7: B5M07_00835Help
Entry
B5M07_00835       CDS       T05714                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00250  Alanine, aspartate and glutamate metabolism
suld00280  Valine, leucine and isoleucine degradation
suld00310  Lysine degradation
suld00410  beta-Alanine metabolism
suld00640  Propanoate metabolism
suld00650  Butanoate metabolism
suld01100  Metabolic pathways
suld01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B5M07_00835
   00650 Butanoate metabolism
    B5M07_00835
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B5M07_00835
   00280 Valine, leucine and isoleucine degradation
    B5M07_00835
   00310 Lysine degradation
    B5M07_00835
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5M07_00835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:suld01007]
    B5M07_00835
Enzymes [BR:suld01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B5M07_00835
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B5M07_00835
    2.6.1.48  5-aminovalerate transaminase
     B5M07_00835
Amino acid related enzymes [BR:suld01007]
 Aminotransferase (transaminase)
  Class III
   B5M07_00835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AYE87608
UniProt: A0A386TIB3
LinkDB All DBs
Position
complement(183261..184598)
Genome map
AA seq 445 aa AA seqDB search
MTVVEANPATKPDGQTNADLVARRDAAVPRGVASAAPIYAKYAENAELWDVEGNRYIDFV
GGIGVLNTGHRHPKVVEAAKAQEDHYTHTSFQVVPYGPYIELAEKLNALAPGEAPKKTLL
VTTGAEAVENAVKIARAATGRPGIIAFTGGYHGRTLLTLGMTGKVTPYKKDVGPFPADVF
RAPFPSVRDGITVQDALTGLKNLFLTDAQPERVAAIIIEPVLGEGGYTPVPFDMLQELRA
ICDQHGILLIADEVQAGFGRTGTWFAIEHSGVAPDLITVAKSMAGGYPLAGVIGRADVMD
AMAPGGLGGTYGGNPVACAAALAAIEAIEDEGLLARSTAMGETLKARFAEIGARSAPYRF
WDIRGLGAMVAVEFVTDFDSAKPDADFTKRVIAHALKRGLLLLSCGMHGNAVRVMVPLTA
SDAIVEEGLAIFEEAVAAAVAEEQK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggtcgaagcaaatcccgccaccaaacccgacggtcagacgaatgccgacctc
gtcgcgcgccgcgacgccgccgtgccgcgcggtgtggcctctgccgcgccgatctatgcg
aaatacgccgagaatgccgaactgtgggatgtcgaaggcaaccgctacatcgatttcgtc
gggggcatcggcgtgctgaacaccggccatcgccaccccaaagtggtcgaagccgccaag
gcacaagaagatcactatacccacaccagctttcaggtcgtgccctacggcccctacatc
gaactggctgagaaactgaacgcgctcgccccgggtgaggcacccaaaaagacgctgctt
gtcaccaccggcgccgaagccgttgagaacgcagtgaaaatcgcccgcgccgccaccggt
cgtccgggcatcatcgccttcaccggcggctaccatggccgcaccctgctgacgctgggc
atgaccggcaaggtcacgccctacaaaaaagacgtgggccctttcccggcagatgtcttc
cgtgcgcctttcccttcggtgcgcgacgggatcaccgtgcaggacgcgctgaccgggttg
aagaacctcttcctcaccgatgcccagcccgagcgcgttgccgcgatcatcatcgagcca
gtgctcggcgaaggcggctatacccctgtgcctttcgacatgctgcaagaactgcgcgca
atctgtgaccagcacggcatcctgctgatcgccgacgaagtgcaggccgggtttggccgc
accggcacatggttcgcgattgagcattccggcgtcgcgccggacctgatcaccgtggcg
aaatccatggccggtgggtacccgctggccggtgtgattggccgcgccgatgtgatggac
gcgatggcccccggcggtctgggcggcacctatggcggcaacccggtggcttgtgctgca
gcgctggcggcgattgaggcgatcgaagacgaaggtctgctggcccgctccaccgcgatg
ggcgaaacgctcaaagcccgctttgccgaaatcggcgcgcggtcggcgccctaccgcttc
tgggatatccgcggccttggtgccatggtcgccgtcgaattcgtaaccgactttgacagc
gccaaacccgatgccgatttcaccaagcgcgtcatcgcccacgccctcaagcgcggcctg
ctgctgctgagttgtggcatgcatggcaacgccgtgcgcgtgatggttccgctgaccgca
tctgacgccatcgtcgaagagggcctcgcgatctttgaagaagccgtcgccgccgctgtc
gccgaagagcaaaaataa

DBGET integrated database retrieval system