KEGG   Sulfitobacter sp. D7: B5M07_05010Help
Entry
B5M07_05010       CDS       T05714                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00020  Citrate cycle (TCA cycle)
suld00190  Oxidative phosphorylation
suld00650  Butanoate metabolism
suld01100  Metabolic pathways
suld01110  Biosynthesis of secondary metabolites
suld01120  Microbial metabolism in diverse environments
suld01130  Biosynthesis of antibiotics
suld01200  Carbon metabolism
Module
suld_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suld_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
suld_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5M07_05010
   00650 Butanoate metabolism
    B5M07_05010
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B5M07_05010
Enzymes [BR:suld01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B5M07_05010
    1.3.5.4  fumarate reductase (quinol)
     B5M07_05010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO FAD_oxidored PEARLI-4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AYE85538
UniProt: A0A386TCL3
LinkDB All DBs
Position
1047437..1049242
Genome map
AA seq 601 aa AA seqDB search
MAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASL
SNMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKQNAEFFIEYFAIDLIMSDDGV
CQGVLCWKLDDGTMHLFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGLPLQDM
EFVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTME
IREGRGVGENKDHIHLHLNHLPPETLDLRLPGISESARIFAGVDLTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTADNPDAIAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAAKIVDADSPVPAPNLKSVEKAFDRFDGLRNAKGGTPTSELRLEMQKTMQADAAVFRTD
KTLEEGREKMIEVADKLNDLHVTDRSLVWNSDLMETLELTNLMPNATATITAAAARKESR
GAHAHEDYPDRNDDEWRKHSLAWFDGNDAKLTYRAVHLDPLTDESEGGIDMKKIAPKARV
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatatgaatatgaaacccacgaatatgacgttgtcgtggtgggggcaggcggt
gctggtctgcgcgcgactttgggcatggcggagcaggggctgcgcacggcttgtatctcc
aaggttttccctacccgttcgcacaccgtggcggcgcagggtggcatcgcggcttccttg
agcaatatgggccccgacaactggcagtggcatatgtatgacacggtcaaaggctctgac
tggctgggcgacaccgacgcgatggaatacctcgcccgcgaagcgcccaaggcggtttac
gagcttgagcattacggcgtgccgttctcgcgcaccgaagagggcaagatctatcagcgt
cccttcggcggccacaccactgaatttggcgaaggcccccccgtgcagcgcacctgtgcc
gccgccgaccggaccggccacgcgatcctgcacacgctttacggccagtcgctgaagcaa
aatgcggaattcttcatcgaatatttcgccatcgatctgatcatgtcggatgacggcgtc
tgccaaggcgtgctctgctggaagctcgacgacggcaccatgcacctgttcagcgccaag
atggtcgtgctggcgacgggcggctatggccgtgcctatttctcggcgacctcggcgcat
acctgcaccggcgacggtggcggcatggcggcccgcgcgggtctgccgctgcaagatatg
gaattcgttcagttccaccccaccggcatctatggtgcgggctgcctgatcaccgaaggc
gcacggggcgaaggtgggtacctcaccaactccgaaggcgagcgtttcatggaacgctac
gcgccgacctacaaagacctcgccagccgcgacgttgtctcgcgctgcatgacgatggaa
atccgcgaaggccgcggtgtgggtgaaaacaaagaccacatccacctgcacctgaaccac
ctgccaccagaaacgctggacctgcgcctgccgggcatctcggaatccgcacgtatcttt
gccggtgtggacctgacgaaagagcccatcccggtgctgccgacggtgcactacaatatg
ggcggcatccccaccaactactggggcgaagtgctgaacccgaccgccgacaaccccgac
gccatcgcacccggcctgatggccgtgggcgaggcgggctgtgcttcggtccacggtgcg
aaccgtctgggttcgaactcgctcatcgacctcgtggtctttggccgcgccgccgcgatc
cgcgcggccaagatcgtcgacgccgacagcccggtgcccgcgccgaacctcaaatcggtg
gaaaaggcatttgatcgtttcgacggtctgcgcaatgccaagggcggcacgccgacctcg
gaactgcgccttgagatgcagaaaaccatgcaggccgatgccgccgttttccgcaccgac
aagacgctggaagagggccgtgagaaaatgatcgaagtggccgacaagctgaacgatctg
catgtcaccgaccgcagtctcgtgtggaactctgatttgatggagacgctggagctgacc
aacctgatgcccaacgccaccgccacgatcaccgccgccgccgcgcgcaaagaaagccgt
ggcgcgcacgcgcatgaggactacccggatcggaacgacgacgaatggcgcaaacactcg
ctggcgtggttcgatggcaatgacgcgaaactcacctaccgcgccgtgcacctcgatccg
ctgaccgacgaatccgaaggcggcatcgacatgaagaagatcgcccccaaggcacgggtg
tattga

DBGET integrated database retrieval system