KEGG   Sulfitobacter sp. D7: B5M07_05020Help
Entry
B5M07_05020       CDS       T05714                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00020  Citrate cycle (TCA cycle)
suld00190  Oxidative phosphorylation
suld00650  Butanoate metabolism
suld01100  Metabolic pathways
suld01110  Biosynthesis of secondary metabolites
suld01120  Microbial metabolism in diverse environments
suld01130  Biosynthesis of antibiotics
suld01200  Carbon metabolism
Module
suld_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suld_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
suld_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5M07_05020
   00650 Butanoate metabolism
    B5M07_05020
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B5M07_05020
Enzymes [BR:suld01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B5M07_05020
    1.3.5.4  fumarate reductase (quinol)
     B5M07_05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AYE85540
UniProt: A0A386TBQ2
LinkDB All DBs
Position
1049588..1050367
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSRMTSGKTWPKPSGATNLREFHVYRWNPDDGKNPALDTYFVDMDDCGPMIL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACTYGMEEINGVVKIYPLPHMP
VVKDLIPDLTHFYAQHASIQPWLETETPEPRKEWKQSIDDRAKLDGLYECIMCACCSTSC
PSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDDLEDPFKLYRCHTIMNCAKTCPKG
LNPAAAIANIKKLMVERTV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaactgacgcttcccaaaaactcccgcatgaccagcggcaagacatggcccaag
ccttcgggcgccaccaacctgcgcgagttccacgtctatcgctggaaccccgatgacggg
aagaacccggcgctcgacacctatttcgtcgacatggacgattgcgggccgatgattctc
gacgcgctgatcaagatcaagaacgagattgaccccacgctgaccttccgccgctcctgc
cgcgaaggcatctgcggctcctgcgcgatgaacatcgacggcatcaacacgctggcctgc
acctacggcatggaggagatcaacggcgtggtcaaaatctacccgctgccgcacatgccg
gtggtcaaagacctgatccccgatctcacgcatttctacgcccagcacgcctcaatccag
ccttggctcgaaaccgagacacccgagccgcgcaaagagtggaaacagtcgatcgacgac
cgggccaagctcgacggtttgtacgagtgcatcatgtgcgcctgctgctcgacatcctgc
cccagctactggtggaacggcgaccgctaccttgggccagccgccctgctgcacgcctac
cgttggatcatcgacagccgggatgaggccacgggcgagcgtctggatgacctcgaagac
ccgttcaagctctaccgctgccacacgatcatgaactgcgccaagacctgccccaagggg
ctgaacccggccgctgcgattgccaatatcaagaaactgatggtcgaacggaccgtctaa

DBGET integrated database retrieval system