KEGG   Sulfitobacter sp. D7: B5M07_17275Help
Entry
B5M07_17275       CDS       T05714                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00270  Cysteine and methionine metabolism
suld00450  Selenocompound metabolism
suld01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B5M07_17275
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B5M07_17275
Enzymes [BR:suld01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     B5M07_17275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 GDC-P Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: AYE87969
UniProt: A0A386TJF5
LinkDB All DBs
Position
p1SUD7:162772..163974
Genome map
AA seq 400 aa AA seqDB search
MTENQKSFSTRAIHHGYDAQSEQGALNPPIYMSSTFTFETAEAGGDMFAGERAGHFYTRI
SNPTLDHLEKRIANLEGAEAGLATASGMGAITSTLWTFLQAGDEIIIDKTLYGCTFAFMT
HGLPRFGVKVTLVDMTEPENLSEVISAQTKIVYFETPANPNNRLVDIAAISAIAHRAGAK
VVVDNTYATPVITRPIEHGADIVLHSATKFLSGHGDVVAGLVVGSAEDMTQVRLVGLKDM
TGAVMSPLTAMLLLRGIKTLELRMERHCATAAKVAEALEAHPAVLHVAYPGLESFPQAEL
ARGQMGNFGGMIPFEVKGGKPGGIAFMNRLHLIQRAVSLGDAESLIQHPASMTHSTYSPE
ERAEHGIAEGLVRLSVGLESAEDIIDDLYAALGAHNMQAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaaccagaaatccttttccacccgcgccatccaccacgggtatgacgcgcaa
agcgaacagggcgcgctgaacccgccgatctacatgagctcgaccttcaccttcgagacc
gccgaggccggcggcgacatgttcgcgggcgagcgcgcggggcatttctatacccgcatt
tccaatccgacgctggaccatctggaaaaacgcattgccaaccttgagggggccgaagcg
ggcctcgccaccgcctcgggcatgggggcgatcacctccacgctctggacattcctgcag
gcgggcgatgagatcatcatcgacaagacgctttatggctgcacctttgcatttatgacc
cacggcctgccgcgctttggcgtcaaggtgacgctggtcgacatgaccgagcctgaaaac
ctttccgaggtgatcagcgctcagaccaagatcgtctatttcgaaacccccgcgaacccg
aacaaccgtctggtggacatcgccgcgatctcggccattgcgcatcgcgccggggccaag
gtggtggtcgacaacacctatgccacgccggtgatcacccgtcccatcgaacatggcgcg
gacatcgtgttgcattcggcgacgaaattcctctccggtcacggtgatgtggtcgcgggt
cttgtcgttggcagtgccgaggacatgacgcaggtgcggcttgtcgggctcaaagacatg
accggtgccgtgatgtcgccgctgaccgccatgctgctcttgcgcgggatcaaaacgctg
gaactgcggatggagcggcactgcgccacggccgccaaggtggccgaggcgctcgaagcg
catccggcggtgctgcatgtcgcctatccggggctggagagctttccgcaggccgaactg
gcgcgggggcagatgggcaatttcggcggcatgatcccctttgaggtcaagggcggcaaa
ccgggcggcatcgcctttatgaaccgtctgcacctcattcagcgcgcggtgagccttggc
gatgcggaaagcctgatccagcatccggcgagcatgacccattccacctattcccccgag
gaacgcgccgagcatggcatcgccgaagggctggtgcggctctcggttgggctggaatct
gcggaagacatcattgatgacctttacgccgcgcttggcgcgcataacatgcaagcggcc
tga

DBGET integrated database retrieval system