KEGG   Sulfuriferula sp. AH1: CAP31_10650
Entry
CAP31_10650       CDS       T04857                                 

Definition
(GenBank) hypothetical protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sulf  Sulfuriferula sp. AH1
Pathway
sulf03030  DNA replication
sulf03430  Mismatch repair
sulf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sulf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CAP31_10650
   03430 Mismatch repair
    CAP31_10650
   03440 Homologous recombination
    CAP31_10650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sulf03032]
    CAP31_10650
   03400 DNA repair and recombination proteins [BR:sulf03400]
    CAP31_10650
Enzymes [BR:sulf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CAP31_10650
DNA replication proteins [BR:sulf03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CAP31_10650
DNA repair and recombination proteins [BR:sulf03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CAP31_10650
SSDB
Motif
Pfam: DNA_pol3_chi DUF3275
Other DBs
NCBI-ProteinID: ARU32092
UniProt: A0A1Y0G8H9
LinkDB
Position
2102733..2103155
AA seq 140 aa
MTRVDFYSNATDKLELARLIIQKAHRQGLSIMVHSTDQQALGELDRRLWSDPATSFLPHC
STEAAHAAQTPVVLGADIGDLSHNDVLINLNDTTPGFFSRFERLIEIVSLDETDRETARQ
RWVFYKQRGYAMSNHDMSKK
NT seq 423 nt   +upstreamnt  +downstreamnt
atgacgcgggtagacttctactccaacgcgacggacaagctcgagctggcgcggctgatc
attcagaaagcgcaccgccagggcttgagcatcatggtgcacagcaccgaccagcaggcg
ctcggcgaactcgaccggcgcttgtggtccgatccggcaaccagctttctgccgcactgc
agcaccgaagctgcgcatgccgcgcagacgccggtggtgctgggtgcggatatcggcgat
ctgagccacaacgatgtgctcatcaatctgaatgatacaacgcccggtttttttagccgc
ttcgagcgcctgatcgaaatcgtcagccttgacgaaaccgaccgcgagaccgcccggcag
cgctgggtgttctacaagcagcgcggctacgcgatgagcaatcacgacatgagcaaaaaa
taa

DBGET integrated database retrieval system