KEGG   Sulfuriferula sp. AH1: CAP31_12380Help
Entry
CAP31_12380       CDS       T04857                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sulf  Sulfuriferula sp. AH1
Pathway
sulf00970  Aminoacyl-tRNA biosynthesis
sulf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sulf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CAP31_12380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sulf03029]
    CAP31_12380
Enzymes [BR:sulf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CAP31_12380
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CAP31_12380
Mitochondrial biogenesis [BR:sulf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CAP31_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ARU32402
UniProt: A0A1Y0G9D3
LinkDB All DBs
Position
complement(2447432..2448886)
Genome map
AA seq 484 aa AA seqDB search
MINASLNQLSALLAAKKISSVELTQTYLDRIAALNPALNAFVTLNADASLADARAADARI
AAGNAAPLTGIPVAHKDIFCADGWRTTCGSRMLENFIAPYDAHVISQFKAAGAVSLGKTN
MDEFAMGSSNETSYYGAVKNPWDHQAVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPA
ALTGITGLKPTYGVVSRYGMIAFASSLDQAGPMAKSAEDCALLMNVMAGFDERDSTSLER
PLEDYTRDLNQPLAGLRIGLPREYFAEGLSADVAATVEAALNEYRKLGATTVDVSLPNTK
LSIPVYYVLAPAEASTNLSRFDGVRYGYRAPEYGDLTDMYEKSRAQGFGTEVKRRIMIGT
YVLSHGYYDAYYMQAQKIRRLIAQDFNEAFQHCDIIMGPTAPSTAFNFGEKADDPVSMYL
SDIYTIAVNLAGLPGMSVPCGLGSNGRPVGLQLIGNYFSEARMLGVAHQYQLATDWHTRM
PENI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgccagtctgaaccaactctctgctttgctcgctgcaaaaaagatttccagt
gtggaattgacgcagacctatctggatcgcatcgccgcactgaacccggcactcaatgcg
ttcgtcacgctgaacgcggatgccagcctggccgatgcccgcgctgccgatgcgcgcatc
gctgcgggcaatgccgcgccgctgaccggcataccggtcgcgcacaaggatattttctgt
gccgatggctggcgcactacctgcggttccagaatgctggagaatttcatcgcgccttac
gacgcgcacgtcatcagccagttcaaagccgccggtgcagtcagtctgggcaagaccaac
atggatgagtttgcgatgggctcatccaatgaaacctcttactacggtgcggtaaagaat
ccctgggatcatcaggccgtacccggcggttcttccggaggctcggcggctgccgtagcg
gcgcgtctggcaccggcagcgacaggtaccgataccggcggttcgatacgccagccggct
gcgctgaccggtattaccggtttgaaaccgacctacggcgtggtgtcgcgttacggcatg
atcgcatttgcatcgagtctggatcaggccgggccgatggcgaaatcggcggaagactgt
gcgttgctgatgaacgtgatggccggctttgacgaacgcgattcgaccagtctggagcgt
ccgctcgaggactatacccgcgacctgaatcagccgctggccggcttgcgcatcgggttg
ccgcgcgagtattttgccgagggcctgagcgccgatgtcgccgcaacagtggaagcggcg
ctaaatgaataccgcaaactgggcgcgaccacggtcgacgtttcgctgcccaacaccaaa
ttgtccatccccgtgtattacgtgctggcaccggcggaagcatcgaccaatctgtcgcgt
ttcgatggcgtgcgttacggctatcgtgcacccgaatacggcgacctgaccgacatgtac
gagaaatcgcgggcgcagggttttggcaccgaggtcaagcgccgcatcatgatcggcact
tatgtgctgtcgcacggttactacgatgcctattacatgcaggcgcagaagatccgccgc
ctgatcgcgcaggatttcaacgaggctttccagcactgcgacatcatcatgggaccgact
gcgccgagcaccgcattcaatttcggtgagaaagcggacgatcctgtttcgatgtatttg
tcggacatttacaccattgcggtcaatctggccggcttgccggggatgtccgtgccttgc
ggcctgggcagcaatggacgtccggtcggcttgcagctgataggcaattatttcagcgaa
gccagaatgctgggcgtcgcgcatcaataccagctggcgacggactggcatacacggatg
cccgaaaacatctaa

DBGET integrated database retrieval system