KEGG   Sulfurimonas sp. GYSZ_1: FJR48_04085
Entry
FJR48_04085       CDS       T06298                                 

Definition
(GenBank) serine/threonine-protein phosphatase
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
sulg  Sulfurimonas sp. GYSZ_1
Pathway
sulg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sulg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    FJR48_04085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sulg02044]
    FJR48_04085
Enzymes [BR:sulg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     FJR48_04085
Secretion system [BR:sulg02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   FJR48_04085
SSDB
Motif
Pfam: PP2C_2 PP2C SpoIIE DsrH
Other DBs
NCBI-ProteinID: QFR48942
UniProt: A0A5P8NZR7
LinkDB
Position
806352..807032
AA seq 226 aa
MKNKSFSFTHPGHKRRVNEDSFYVNDEKGLWVVCDGMGGHEEGLFASSLATDSFSALELN
STFNDNVERILQTIHFIKQQLDKKVYTLDINDFVGTTLILLYIKDGKALCISAGDSRCYI
LRNDKLSLVNKDHTRDVIDAKQETRSVLTNAIFAPGDINIDIKKFTINKNDVFLLCSDGL
YSYLNIKEIKHAMNLAFEGRGLNLLKTSVLSQDADDNLTGAMICVL
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaaaaataaaagtttttcttttacacaccctggacataaaagaagagttaacgaagac
tctttttatgtaaatgatgaaaaaggattatgggttgtttgtgatggtatgggtggacat
gaagaaggtttgtttgccagtagtttagcaactgatagtttttcagctttagaactaaac
tcaacttttaatgataatgtcgaaagaattctacaaactattcattttattaaacaacag
cttgataaaaaagtttatactttagatattaatgattttgtcggtacaactctaatatta
ctatatattaaagatggtaaagcattatgtataagtgccggtgattcaaggtgttatata
ttaaggaatgataagttatcactagttaataaagatcatacaagagatgtaatcgatgcg
aaacaagaaaccagaagtgttttaacaaatgcaatttttgcacctggagatataaatata
gatataaagaagtttactataaataaaaatgatgtttttttattgtgtagcgatggttta
tactcttatttaaatatcaaagaaataaagcatgctatgaatctggcatttgaaggtaga
gggttaaatttactgaaaacatctgttctttctcaagatgctgacgataatttaacaggt
gctatgatatgtgtattatag

DBGET integrated database retrieval system