KEGG   Sulfitobacter sp. JL08: C1J05_08975Help
Entry
C1J05_08975       CDS       T05585                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
suli  Sulfitobacter sp. JL08
Pathway
suli00030  Pentose phosphate pathway
suli01100  Metabolic pathways
suli01110  Biosynthesis of secondary metabolites
suli01120  Microbial metabolism in diverse environments
suli01130  Biosynthesis of antibiotics
suli01200  Carbon metabolism
suli01230  Biosynthesis of amino acids
Module
suli_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
suli_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
suli_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:suli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C1J05_08975 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    C1J05_08975 (tkt)
Enzymes [BR:suli01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     C1J05_08975 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr E1_dh Transketolase_C DXP_synthase_N TPP_enzyme_C DUF4192
Motif
Other DBs
NCBI-ProteinID: AXI54609
UniProt: A0A345RAM2
LinkDB All DBs
Position
complement(1810640..1812661)
Genome map
AA seq 673 aa AA seqDB search
MDIAALSAAHPDHWSKATAIRTLTLDAVKAANSGHSGMPMGMADVATVLFEKHLKFDASA
PNWPDRDRFILSAGHGSMLLYSLLYLTGYKDMSLEEIKNFRQWGSRTAGHPEYGHAAGIE
TTTGPLGQGISNAVGFAMAEEMQRAHYGRKAVDHFTYVIAGDGCLMEGVSQEAIGLAGRH
ELSKLIVLWDNNNITIDGTVDIADRTDQVARFKASGWNVLEIDGHDPVAIDAALTQAKKG
NKPTMVACKTHIALGHAAQDTSKGHGALTDEDQLAAAKAAYGWKTGPFEIPADVKSAWEA
IGARGATTRAEWEARFATLPGNKQREFNRAYALDAPKKLSATIKAFKKQMTESAPKLATR
ASSEKVLEVINPIMHETVGGSADLTGSNNTKTADLGVFLPENRKGRYIHYGIREHGMAAA
MNGMVLHGGMRPYGGTFMCFTDYARPAIRLAALMRIPTVFVMTHDSIGLGEDGPTHQPVE
HLAISRATPNTYVFRPADTIETAEAWEIALTSKETPSVLSLTRQGLRTVRTEHKTKNMTA
QGGYVLADAEGKREAILMATGSEVEIALAARDLLQAEGIGTRVVSMPCWELFEDQDERYR
KRVLPGGPVRVAIEAGIRFGWDRWLFGERGKREKSGFIGMHGFGASAPADVLYEQFGITA
EATAAKVKSLLKK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtggacattgccgccctttctgccgcccatccggatcactggtccaaagcgacggcgatc
cggacactgacacttgacgcggtcaaggccgcaaattcgggccattccggtatgccgatg
ggaatggccgacgtggcgacggtgttgtttgaaaagcacctgaaattcgatgcttctgcc
cccaactggccggaccgcgaccggttcatcctgtcggccggtcacggttccatgttgctt
tattcgctgctctatctcacgggctacaaggatatgtcactggaagaaatcaagaatttc
cgccagtggggatcgcgcacggcgggccatccagaatatggccatgcggcagggatcgaa
accacgaccggcccgctgggacagggcatatcaaacgcggtcggctttgccatggccgaa
gaaatgcagcgcgcgcattacgggcgcaaggcggtcgatcatttcacctatgtcatcgcc
ggtgacggatgtctgatggaaggcgtcagccaggaagcgatcgggctggccggacggcac
gagctgagcaagctgatcgtgctgtgggacaataacaacatcaccatcgacggaaccgtc
gatattgccgaccgcaccgatcaggtcgcgcggttcaaggcatccggctggaatgttctg
gaaattgacgggcacgatccggtggcgattgacgcggccctgacgcaggcaaaaaagggc
aacaaacccacgatggtggcatgcaagacgcatatcgctctgggtcacgcggcgcaggac
acatccaaaggccacggcgccctgaccgatgaagaccagctggctgcggccaaggcggcc
tatggctggaagacgggcccgtttgaaattcccgccgatgtcaaatcggcatgggaagcg
attggcgcgcgcggcgcaacaacacgcgcggaatgggaggcacgctttgccaccctgccc
ggcaacaagcagcgcgagttcaaccgcgcctatgctttggatgccccgaaaaagctaagc
gcgacaatcaaggcgttcaaaaaacagatgaccgaaagtgcgccgaaactggcaacgcgc
gcttcatcggaaaaagtgttggaagtgatcaatccgatcatgcacgaaaccgtcggcggc
agcgccgatctgaccggatcgaacaacacgaaaaccgccgatctgggcgtgttcctgccg
gaaaaccgcaaagggcgctacattcattacggcatccgcgaacacggcatggccgccgca
atgaacggcatggtgctgcatggcggtatgcgcccctatggtggcacgttcatgtgtttc
accgattacgcgcgccccgccatacgtctggccgcgctgatgcgcatcccgaccgtgttc
gtgatgacgcatgacagcatcgggctgggcgaagacggcccgacccaccagccggtggaa
catctggcaatttcacgtgccacaccgaacacctatgtgttccgccccgccgatacgatt
gaaaccgccgaagcatgggaaattgccctgaccagcaaggaaacgccatcggttctgtcg
ctgactcgtcagggcctgcgcaccgtgcgcaccgagcacaagaccaagaacatgaccgca
cagggcggctatgttctggccgatgccgaaggaaagcgcgaggcaatcctgatggccact
ggatcagaggtcgaaatcgcactggccgcccgcgatctgttgcaggccgaaggcatcggg
acgcgcgttgtgtccatgccgtgttgggaactgttcgaagatcaggacgagcgctatcgc
aagcgcgttctgcccggcggccctgtgcgcgtcgcgatcgaggccggtatccggttcggc
tgggaccggtggttgttcggcgagcgcggcaagcgggaaaaatccggttttatcgggatg
cacggtttcggcgcatcggcccctgcggatgttctttatgaacaattcggcatcaccgct
gaagcgaccgcggccaaggtaaaatcactgctgaagaaatga

DBGET integrated database retrieval system