KEGG   Sulfitobacter sp. JL08: C1J05_16640Help
Entry
C1J05_16640       CDS       T05585                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
suli  Sulfitobacter sp. JL08
Pathway
suli00240  Pyrimidine metabolism
suli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suli00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C1J05_16640
Enzymes [BR:suli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C1J05_16640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AXI55903
UniProt: A0A345REB6
LinkDB All DBs
Position
3383458..3384045
Genome map
AA seq 195 aa AA seqDB search
MAKLYFHFSTMNAGKSTVLLQAAHNYRERGMQTYLLTAQFDKRAGEGRIASRIGIGEPAD
TFAPGEDLFAKLQSRMQFGPVACVFVDEAQFLEKDQVWQLARAVDDLNVPVMCYGLRVDF
RGALFPGSAELLALSDEMREVRTICHCGKKATMVIRQDANGKVVTDGAQVQIGGNETYVS
LCRRHWRAATGDAPV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgtattttcatttttccaccatgaatgccggtaaatcgacggttctgttg
caggctgcgcataactatcgcgagcgcggtatgcagacctatcttttgaccgcccagttc
gacaaacgcgccggagagggacgaatcgcatcgcggatcggcataggagaacctgcagac
acatttgctccgggcgaagatctgtttgcgaaactgcaatcacggatgcaattcggcccc
gttgcctgcgtgtttgtggacgaagcccagtttcttgagaaagatcaggtgtggcaactg
gcccgtgccgtcgacgatctgaacgtgccggtcatgtgctacgggctgcgggtcgatttt
cgcggcgcgctgtttcccggttctgccgaattgctggccctgtctgacgaaatgcgtgaa
gtgcgcaccatctgccattgcggaaaaaaggcaacgatggtgatccggcaggacgcaaac
ggtaaggtagtgaccgacggggcacaggtacagatcggcggaaatgaaacctatgtgtcg
ctgtgccgacgacattggcgcgccgccaccggcgacgcacctgtctga

DBGET integrated database retrieval system