KEGG   Sulfurospirillum sp. JPD-1: SJPD1_0840Help
Entry
SJPD1_0840        CDS       T05109                                 

Definition
(GenBank) periplasmic methylmenaquinol:fumarate reductase, catalytic subunit MfrA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sulj  Sulfurospirillum sp. JPD-1
Pathway
sulj00020  Citrate cycle (TCA cycle)
sulj00190  Oxidative phosphorylation
sulj00650  Butanoate metabolism
sulj01100  Metabolic pathways
sulj01110  Biosynthesis of secondary metabolites
sulj01120  Microbial metabolism in diverse environments
sulj01130  Biosynthesis of antibiotics
sulj01200  Carbon metabolism
Module
sulj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sulj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sulj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJPD1_0840
   00650 Butanoate metabolism
    SJPD1_0840
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SJPD1_0840
Enzymes [BR:sulj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SJPD1_0840
    1.3.5.4  fumarate reductase (quinol)
     SJPD1_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO HI0933_like Pyr_redox_2 Thi4 FAD_oxidored GIDA Pyr_redox_3 Lycopene_cycl NAD_binding_8 AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ATB68953
UniProt: A0A290HBM5
LinkDB All DBs
Position
808501..810351
Genome map
AA seq 616 aa AA seqDB search
MTEQFTRREFLQSACITMGALAVSTTGVEKAFAATSASTPNASGMPSCDVLIIGSGAAGL
RAAVAARKKNPNLSVVVVSKVMPTRSATTMAEGGINGVIDFSDGDSFESHAKDTVKGGDY
LVDQDTAMKFATYAGAAIHELDYIGMPFSRDSKGHVAKRFAGGAAKKRCNYAADKTGHIL
THTCLDDALKHGVKFLMDHHMLDLSIENGHCEGVVLRNIRTGDIAPVRAKSVVLATGGYT
RVFWNRTSTPYIATGDGAAAALRAGLIFKDPEMLQFHPTGVCHGGTLITEAARGEGGILL
NSLGERFMKRYVPNKMELAPRDIVSRSIENEIREGRGFGHDMEAYVLLDVTHLGREKIMR
DLPQIRHIGLLFENMDLIEKPIAIRPTAHYSMGGIHVESLDTMATPAPGLFAAGEAACVS
IHGANRLGGNSLCDATVTGKIAGDNAAEYAAKADFGAGKRLNDLTLKWISHFKEITGSNK
GNVNDMYALREELGAANWYNMGIFRTEAKMLALADKHTELQARYDALRIPNANPICNTAF
TEYVELGNLLLASRAALMGATARKESRGSHFREDYLKRDDENFLKHSMVTMDESGKMHLA
WKDVVVGQFKIEERKY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagtttacccgcagagaatttctgcaatcagcctgtattacgatgggcgca
ttggcagtaagtacaacgggtgttgagaaggcttttgctgcaacttctgcttcaacacct
aatgcttcaggaatgccaagttgtgatgttttgattattggttctggtgccgcaggtctt
agagcggctgttgctgcgcgtaaaaagaacccaaatcttagtgtcgtcgttgtcagtaaa
gtgatgccaacacgtagtgccacaacgatggctgaaggtggcattaatggggtcattgat
tttagtgatggagactcttttgaatcacatgctaaagataccgtcaaaggtggcgattac
cttgtggatcaagatacggcaatgaaatttgcgacttacgcgggagctgctattcatgaa
cttgattacattggtatgcctttttcacgtgatagcaagggacatgttgcgaagcgtttt
gcgggtggtgccgctaaaaagcgttgtaattatgctgccgataaaacgggacacatttta
acgcacacctgtttggacgatgcgttaaaacatggcgttaagtttttaatggatcatcac
atgctagaccttagcattgaaaatggtcactgtgaaggtgttgttcttcgtaacattcgt
acgggtgatattgctcctgtccgtgcaaaatcagttgtgctagcaacgggaggttatacc
cgtgtgttttggaacagaacatcaaccccttacattgccaccggtgatggtgccgcagca
gctttacgtgcaggcttaatctttaaagatccagagatgctccaatttcaccccacaggt
gtctgccacggtggtacactgattaccgaagcggcacgtggtgaaggcggtatcttactt
aatagccttggcgagcgttttatgaaacgttatgttccaaacaagatggaactagcccct
cgtgatattgtttctcgttctattgagaatgaaattcgtgaaggtcgcggttttggtcat
gatatggaagcctacgttcttctcgacgtaacgcatttgggtcgtgaaaaaatcatgaga
gacttacctcaaattcgccatattggtcttttatttgagaacatggacttgattgaaaaa
ccgattgccattcgtccgacagcgcactactccatgggcggtattcacgttgagagtctt
gataccatggcaacaccggctccgggtctttttgcggcaggtgaggcagcgtgtgtctcc
attcacggtgcaaaccgtttgggcggtaactctttgtgtgatgcaacggttactggaaaa
attgcaggtgataatgctgctgagtatgctgcaaaagcagactttggtgcaggaaaacgt
ctgaatgatttaaccctaaaatggatcagccactttaaagaaattacaggctcaaataaa
ggtaatgtcaacgatatgtatgcacttcgtgaagaactcggtgctgcaaactggtacaac
atgggaatttttcgtactgaagcaaaaatgctcgcccttgctgacaagcatacagaattg
caagcgcgttacgatgcccttcgcatcccaaacgcaaacccaatatgcaatacggcattt
acagagtatgttgaacttggtaacttattactcgcatctcgcgcagcgctcatgggtgct
actgcgcgtaaagaatcacgtggttcacacttcagagaagattatttgaagcgcgacgat
gagaatttccttaaacactcaatggtcacaatggatgagagcggtaaaatgcacttagca
tggaaagatgttgtggtcggtcagttcaaaattgaagagaggaaatactaa

DBGET integrated database retrieval system