KEGG   Sulfurospirillum sp. JPD-1: SJPD1_0841Help
Entry
SJPD1_0841        CDS       T05109                                 

Definition
(GenBank) periplasmic methylmenaquinol:fumarate reductase, FeS cluster subunit MfrB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sulj  Sulfurospirillum sp. JPD-1
Pathway
sulj00020  Citrate cycle (TCA cycle)
sulj00190  Oxidative phosphorylation
sulj00650  Butanoate metabolism
sulj01100  Metabolic pathways
sulj01110  Biosynthesis of secondary metabolites
sulj01120  Microbial metabolism in diverse environments
sulj01130  Biosynthesis of antibiotics
sulj01200  Carbon metabolism
Module
sulj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sulj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sulj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJPD1_0841
   00650 Butanoate metabolism
    SJPD1_0841
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SJPD1_0841
Enzymes [BR:sulj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SJPD1_0841
    1.3.5.4  fumarate reductase (quinol)
     SJPD1_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_9 Fer4_17 Fer4_7 Fer2 Fer4_15 Fer4_10 Fer4_18 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ATB68954
UniProt: A0A290HQQ1
LinkDB All DBs
Position
810351..811310
Genome map
AA seq 319 aa AA seqDB search
MKFIIDRFDGKKNYQQTYTVEKKDIEALTLLGTLLFIKQHLDLTLNFTASCRMAICGACG
VRVNGHSYLGCDTKMTELFEEYKDADMFQISPLANYTVLSDLVVDWEPAIENLRKIKPGL
VAKDKFSEKEGCVQNQEEYDRIVKQWDCILCGVCASECNKLTADRSDYMEPFVFTQAWRL
ANDSRSKDPMTNVKPAVANGLWNCVHCHECTNRCPKHISAAEDIAGLRALALRKGLNSGV
GPAHAKSFYTDLVEDSGRLNEIRLALRTEGVSTALRAGTAITLMRAGKMNPLEIFGGHEI
EGHKELVKMIEAAHAANKE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatcattgatcgctttgatggcaaaaaaaattatcaacaaacgtatacggtt
gagaaaaaggatattgaagcattaaccttgcttggtactttgctttttattaaacaacat
cttgatcttacactcaatttcacagcatcctgtcgtatggccatttgtggtgcgtgtggt
gtgcgtgtcaatgggcactcctaccttggttgcgacactaaaatgacagagctttttgaa
gagtacaaagatgctgacatgttccagatttctccactcgcaaactataccgttctttct
gatcttgtcgtagattgggagcctgcgatcgagaatttacggaaaataaaaccgggtctt
gtcgctaaagataaattctcagaaaaagagggttgtgttcaaaatcaagaagagtacgat
cgtattgtcaaacaatgggattgtattttatgtggcgtgtgtgcttctgagtgtaataaa
cttaccgcagatcgctctgattatatggaaccattcgtctttacgcaagcatggcgtctt
gctaatgattcacgtagtaaagatccaatgacgaatgtaaaaccagccgtagcgaatggt
ctatggaattgtgttcattgccatgagtgcacgaatcgttgtcctaaacatattagtgct
gcggaggacattgcaggcttacgtgcattagcattaagaaaaggtcttaacagtggtgtt
ggtccagcgcatgctaaatcgttctatacagatttagtggaagattcaggacgactcaat
gaaatccgacttgcgcttagaacagaaggtgtcagtacagcacttcgcgcaggaaccgct
attacacttatgcgtgcaggtaaaatgaatccactcgaaatttttggtggtcatgagatt
gaaggtcataaagagttagtaaaaatgattgaagcagcgcatgctgcaaacaaggagtaa

DBGET integrated database retrieval system