Sulfurospirillum diekertiae JPD-1: SJPD1_1377 Help Entry SJPD1_1377        CDS       T05109                                  Name (GenBank) putative tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sulj  Sulfurospirillum diekertiae JPD-1 Pathway sulj00362   Benzoate degradation sulj01100   Metabolic pathways sulj01120   Microbial metabolism in diverse environments sulj01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sulj00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     SJPD1_1377    00622 Xylene degradation     SJPD1_1377    00621 Dioxin degradation     SJPD1_1377 Enzymes [BR:sulj01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      SJPD1_1377 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 CinA_KH Tautomerase_3 Motif Other DBs NCBI-ProteinID:  ATB69487 UniProt:  A0A1Y0HLZ6 LinkDB All DBs Position 1320295..1320501 Genome browser AA seq 68 aa AA seqDB search MPYVNIKITKEGATKEQKEELIAGVTNLLVSVLGKNPATTVVTIDEVDMDNWGIGGQQVS ELRKKPKP NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccttatgttaatatcaaaatcaccaaagagggtgcaacaaaagagcaaaaagaagag cttattgcaggagtcacgaaccttttggtcagtgtgcttggtaaaaatccagccacaaca gttgttacgattgacgaagtggatatggataattggggaattggtgggcaacaggtcagc gaacttcgcaaaaagccgaagccttaa

DBGET integrated database retrieval system