KEGG   Sulfurospirillum sp. JPD-1: SJPD1_2576Help
Entry
SJPD1_2576        CDS       T05109                                 

Definition
(GenBank) Sulfate/thiosulfate import ATP-binding protein CysA
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
sulj  Sulfurospirillum sp. JPD-1
Pathway
sulj00920  Sulfur metabolism
sulj02010  ABC transporters
Module
sulj_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:sulj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SJPD1_2576
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SJPD1_2576
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sulj02000]
    SJPD1_2576
Enzymes [BR:sulj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     SJPD1_2576
Transporters [BR:sulj02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    SJPD1_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CysA_C_terminal AAA_21 TOBE_3 SMC_N AAA_16 AAA_22 ATPase AAA TniB NACHT RsgA_GTPase AAA_30 AAA_5 AAA_29 AAA_23 AAA_24 AAA_25 AAA_14 SbcCD_C ATPase_2 AAA_33 AAA_18 AAA_28 DLIC TsaE cobW RecA
Motif
Other DBs
NCBI-ProteinID: ATB70670
UniProt: A0A290HYD6
LinkDB All DBs
Position
complement(2490922..2492001)
Genome map
AA seq 359 aa AA seqDB search
MSIQISNINKRFDTFTALDNINLTIPDGELVALLGPSGSGKTTLLRIIAGLEEADSGTIY
FNGEDTTATHVRDRGVGFVFQHYALFRHMSVFENVAFGLRVRPKATRPSEEEITERVHKL
LKLIQLDWIANRYPSQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAKVRQELRQWLR
NLHDEIHITSVFVTHDQEEALEVSDKIVVMNQGKIEQIGTPEEVYDRPANPFVYGFLGNV
NLFHARVEQGSLHLENTELNTPDLGSSKEASLFVRPHEIHISIDNAIGGGIEAKLIGWRL
VGPRVRVELETLHERQKVEAEISKTEWQAIKAYESGALFVHFESARIYTNEALWNDYVI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcagatttcaaatattaataaacgttttgatacttttacagccctcgataac
atcaatttgaccattcccgatggtgaacttgtagcgcttcttggcccttcaggctcaggg
aaaacgaccctgcttcgcatcattgcaggactagaagaggcggatagtggaacgatttat
tttaatggagaagatacgaccgcaacgcatgtgcgtgatcggggagtggggtttgtattt
cagcactacgcgctttttcgtcacatgagtgtgtttgaaaatgttgcctttggacttcgt
gtgcgtcccaaagcaacacgtccgagtgaagaggagattacagagcgggtccataaactg
ctgaaactcattcagctggattggattgctaatcgctatccctcacaactctcaggtggg
caacgccaacgtgttgcgcttgcacgtgcgcttgccgtggagcctaaggtattgttgctc
gatgaaccttttggagctctggatgctaaagtgcgccaagaactgcgccagtggcttcgt
aatctacacgatgaaattcacattaccagtgtctttgtgacccacgaccaagaagaggca
cttgaagtttccgataaaatcgttgtgatgaatcaaggcaaaatcgagcaaatcggcacg
cccgaagaggtgtatgaccgacctgctaatccgtttgtctatggcttcttgggtaatgtc
aatctgtttcacgcccgtgtggagcaaggctcactgcaccttgaaaacaccgagctaaat
acgcccgatcttgggagctccaaagaagcatcgctttttgttcgtccgcatgaaattcat
attagtattgataatgccattggtggtggcatcgaggcgaagctgattggctggagattg
gtaggtcctcgtgtgagagtcgagcttgaaacactgcatgagcgccaaaaggtggaagct
gagatttcaaaaaccgaatggcaagcaattaaagcgtatgaaagtggcgctttgtttgtc
cattttgagagtgcacgcatctatacgaatgaggctttatggaatgattatgtcatttaa

DBGET integrated database retrieval system