KEGG   Sulfurospirillum sp. JPD-1: SJPD1_2745Help
Entry
SJPD1_2745        CDS       T05109                                 

Definition
(GenBank) Multiple antibiotic resistance protein MarR
Organism
sulj  Sulfurospirillum sp. JPD-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 TrmB HTH_24 B-block_TFIIIC Herpes_UL79
Motif
Other DBs
NCBI-ProteinID: ATB70834
UniProt: A0A290HW14
LinkDB All DBs
Position
2660007..2660444
Genome map
AA seq 145 aa AA seqDB search
MNFDMDNSLGFILNKTALFSKAHFNNLIKPYDISPEQWSLIFRVVERSGLTQKELSDSTY
KDQANITRSIDRLEQKGLLKRIEHPSDRRSFQLIPTQEALTLVEQVVPLSQAFNQRLSKG
LSEAEAQMLIVLLKKVHHTLEGEPC
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgatatggacaattctttaggatttattcttaacaaaaccgccctcttttcc
aaagcgcatttcaataatcttatcaaaccgtacgatatttcgcccgaacagtggtcgctc
atttttcgtgttgtggaacgaagcggtctgacgcaaaaagagctttccgattcgacctac
aaagatcaggccaatatcacgagaagcattgaccgtttggagcaaaaaggattattgaaa
cgcatcgaacacccgagtgaccgtaggtcttttcaactgattcccacgcaagaagcgctc
acgcttgtggagcaggtcgtgccgctttctcaagcatttaaccaacgcctcagcaaaggt
ttgagtgaagcagaggcgcaaatgctcatcgtattactcaaaaaagtgcatcatacttta
gaaggagaaccatgttaa

DBGET integrated database retrieval system