KEGG   Candidatus Sulfuricurvum sp. RIFRC-1: B649_07925Help
Entry
B649_07925        CDS       T02537                                 

Definition
(GenBank) peptidase s11 d-alanyl-d-alanine carboxypeptidase 1
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sulr  Candidatus Sulfuricurvum sp. RIFRC-1
Pathway
sulr00550  Peptidoglycan biosynthesis
sulr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sulr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B649_07925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sulr01002]
    B649_07925
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sulr01011]
    B649_07925
Enzymes [BR:sulr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B649_07925
Peptidases and inhibitors [BR:sulr01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   B649_07925
Peptidoglycan biosynthesis and degradation proteins [BR:sulr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   B649_07925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AFV97897
UniProt: K7SED4
LinkDB All DBs
Position
1600233..1601063
Genome map
AA seq 276 aa AA seqDB search
MIYRYLTLICLLLTLSSHAEIDKNGLDKLNVEALLVKELTSGEVIYSKEALKEVKPASLT
KIMTAMLAIEQGNLDRPVTITAEMIAVEPTKAGYKEGEVIRLEDLIKAAMIKSDNDAAMA
IAISVGGDLNTFVQMMNLKAAQIGMDNTFFTNPCGFDIANHHSTPIDLLHLAEYAIQNSL
FNDITRQNQHIYYSLNTNRKFVAKTHNYLLNRYEYAVGVKTGYTSKAGPCLIARAKKEGN
DCLIVMLNSKENRWSVAQQIFEQVFLLPVIEYWEEV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatatatcgatatttaactcttatatgtttacttctcaccctatcttcacacgcagaa
atcgataaaaacggacttgataaactcaatgtcgaagcactgctggtcaaagagctcaca
tccggtgaagtgatttattccaaagaagccctcaaggaggtcaaaccggccagtcttacc
aagattatgactgctatgctggcgattgaacaggggaatttggatcgtccggtgacgatc
accgcagagatgatagccgtcgaaccgaccaaagcgggctacaaagagggagaggttatt
cgtctcgaagatctgatcaaagcagccatgatcaaatccgataacgatgcggcaatggcg
attgcgatcagcgtggggggagatctaaatacgtttgtccagatgatgaacctcaaagct
gctcaaatcggtatggacaatacttttttcaccaatccttgcggctttgatatcgctaac
caccattcaaccccgatagaccttctgcaccttgcagaatatgccattcaaaactctctt
tttaacgatatcacccgacagaatcaacatatttattactcactcaatacgaatcgtaaa
tttgttgccaaaacccataactatcttttgaatcgctacgaatatgcggtaggagttaaa
accggttacacctctaaagcaggcccttgtctcatcgcacgtgccaaaaaagaggggaat
gactgcctaatcgtgatgctcaactcgaaagaaaatcgctggagtgtagctcaacagatt
tttgaacaagtgtttttattacctgtcatcgaatattgggaagaggtatag

DBGET integrated database retrieval system