KEGG   Candidatus Sulfuricurvum sp. RIFRC-1: B649_10305Help
Entry
B649_10305        CDS       T02537                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
sulr  Candidatus Sulfuricurvum sp. RIFRC-1
Brite
KEGG Orthology (KO) [BR:sulr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    B649_10305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB DUF3429
Motif
Other DBs
NCBI-ProteinID: AFV98373
UniProt: K7S6F3
LinkDB All DBs
Position
2058660..2059028
Genome map
AA seq 122 aa AA seqDB search
MSLKAYLEANISGFALSALSIFPFLLLWSIFFLIYKIAVNADVSIKAAAISSFIVAVVWG
IAKNSFVQYVFYNKTYATMYGSFSALIFFFLWIYVSWIIVIYGMKLCYLINRATQRSETQ
NT
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagccttaaagcttatttagaagcaaatatcagcggatttgcgctgagcgccctctcg
attttcccttttctcttgctgtggagtattttctttttgatctataaaattgctgtcaat
gccgatgtctcgattaaagcagcagcaatcagctcatttatcgtagccgttgtttgggga
atcgctaaaaatagttttgtccaatacgttttttataataaaacctacgccacgatgtac
ggctctttttcagcccttatcttttttttcttatggatttacgtctcgtggatcatcgtt
atctatgggatgaagctatgctatctgataaaccgcgctacccagcgtagcgagacccaa
aacacctaa

DBGET integrated database retrieval system