KEGG   Sulfurospirillum sp. SL2-1: Sdiek1_0219Help
Entry
Sdiek1_0219       CDS       T04910                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
suls  Sulfurospirillum sp. SL2-1
Pathway
suls00061  Fatty acid biosynthesis
suls00780  Biotin metabolism
suls01100  Metabolic pathways
suls01212  Fatty acid metabolism
Module
suls_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:suls00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Sdiek1_0219
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Sdiek1_0219
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:suls01004]
    Sdiek1_0219
Enzymes [BR:suls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Sdiek1_0219
Lipid biosynthesis proteins [BR:suls01004]
 Fatty acid synthase
  Component type
   Sdiek1_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ARU47402
UniProt: A0A1Y0HHB3
LinkDB All DBs
Position
202045..202494
Genome map
AA seq 149 aa AA seqDB search
MLIDVVEIQKILPHRFPFLLVDRITALTPGESIEGFKNITIGEQIFQGHFPDHPIYPGVM
IIEGMAQAGGVLAFKSMDEEKQEETQEKVVYFMSIDNAKFRSPVKPGDQLVYKLNVLKHR
GNIWVLDAKAYVDDKLVAEAELKAMIVDK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgatgttgtagagattcaaaaaatacttccccatcgctttccttttttactt
gtggatagaattactgcacttacgccaggtgagtctatcgaaggatttaaaaatattaca
ataggtgagcagatttttcaaggacattttcctgatcatccaatttaccctggtgttatg
attattgagggtatggcacaagctggtggcgtgcttgcgtttaaaagcatggatgaagag
aagcaagaagagacgcaagaaaaagtggtttattttatgagtatcgataatgccaaattt
agaagtcctgtaaagccaggagatcagttagtgtacaaacttaatgttctaaaacacaga
ggtaatatctgggttttagatgccaaagcctatgttgacgacaaacttgtcgccgaagca
gagcttaaagctatgatagtggacaaataa

DBGET integrated database retrieval system