KEGG   Sulfitobacter sp. SK012: C1J03_02910
Entry
C1J03_02910       CDS       T05563                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
sulz  Sulfitobacter sp. SK012
Pathway
sulz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sulz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C1J03_02910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sulz01001]
    C1J03_02910
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sulz02022]
    C1J03_02910
Enzymes [BR:sulz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     C1J03_02910
Protein kinases [BR:sulz01001]
 Histidine kinases
  OmpR family
   C1J03_02910
Two-component system [BR:sulz02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   C1J03_02910
SSDB
Motif
Pfam: Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2
Other DBs
NCBI-ProteinID: AXI48713
UniProt: A0A345QTS6
LinkDB
Position
591311..593005
AA seq 564 aa
MRDLAPPTRDGDVVLGDDWVSPDNAAPNEIRVRRERRGLFSLRASPLTRKIITFNLIALN
VLVAGILYLNSSRDSLAVQRAASLVSEAELIADVIEAQLPISGSVDLAAKTDVDVASTLD
GLDLRSGIEVFVYGTDGGLIARSEGALDTQNVKGVPQSSDKTLLTDGLSWLWLKVSAPFG
GGREEVKIEDRLKPLISESFEGGTQIKKDFDETGGTLFTVATPIQLGGQAVGAIAIASAA
GEIDRFVRGERERVLQMFVIATLVSIGLSLVLASTIANPLADLAAAAELGRDKDARKMNP
GRIRIPDLTARPDEIGRLSGALRGMISALYNRIDGNEQFAADVAHEIKNPLASLRSAVGT
LRMIKREDQRMKLLDVIDHDVRRLDRLVSDISNASRLDSELVKEEEEPFDLLVMLGNLGQ
YLGEDAKTKGIDFIVDMPKDPIIVHGLEARLAQVFVNLITNAVSFCEDGDAIRVWARKRA
NRVLVVVEDTGPGIPDQALTKVFTRFYSQRPDEHFGNNSGLGLAISKQIVEAHGGVIWAE
NIRPTEADITSEPLGARFVVGLPI
NT seq 1695 nt   +upstreamnt  +downstreamnt
gtgcgcgatttagccccccctacgcgggatggtgatgttgttctgggcgacgattgggtc
tccccggacaatgccgctccgaatgaaatcagggtgcgccgtgagcggcgcggcctgttt
tcgttgcgcgcctctcctctgactcgcaagatcatcaccttcaacctgattgcgttgaat
gtgctggtggcaggtatcctctacctcaactcatctcgtgacagcttggccgtccagcgc
gcggcgtctttggtgtccgaagccgagctgattgcggatgtgatcgaagcacaattgccg
atcagcggcagcgtcgacttggcagctaagacagatgtcgatgttgcaagtacactcgac
ggcttggacctgcgaagcgggatcgaagtttttgtctacgggacagatggtgggctgatc
gcgcgctccgagggggcgcttgatacgcaaaacgttaagggtgttcctcagtcttcggac
aagacattgctgaccgacggcttaagctggctgtggttgaaggtctccgcgcctttcggt
ggtggtcgtgaagaggtcaagatcgaagaccgtctaaagccgcttatctccgaaagcttt
gagggcgggacgcaaatcaagaaggactttgatgagactggcgggacgctgtttactgtt
gcgacgcctatacaactgggtgggcaagccgtcggagccatcgcaatagccagtgccgcg
ggtgagattgaccgctttgtgcgtggtgaacgagagcgggtcctccagatgttcgtgatt
gcgacgcttgtcagcatcggtcttagccttgtgttggcctcaacgattgccaacccgctt
gccgatctggccgctgctgcagaacttgggcgagacaaagatgcccgaaagatgaaccct
ggccgcattcggatccctgacctgacggcgcgcccggatgagattggccgactgagcggg
gctctgcgcggcatgatttccgcgctctacaaccgcattgacggcaatgaacaatttgca
gctgatgtggcgcatgagatcaagaatccgctggcgtcgctacggtctgccgtcggcaca
cttcggatgatcaaacgcgaagatcagcggatgaaattgctagatgttatcgatcatgat
gtacgccggttggaccgtctggtaagcgatatttccaacgcttcgcgattggacagcgag
ttggtcaaagaagaagaagagccctttgatttgctcgtgatgctgggcaatttgggccaa
taccttggcgaagacgccaagaccaagggcatcgatttcattgttgatatgccgaaagat
ccgatcatcgttcacggtcttgaagcacgcctggcgcaagtgttcgtcaatctgatcacc
aacgcagtttcattttgcgaggacggcgacgcaatccgcgtttgggcgcgtaagcgggcc
aatcgcgtgttggttgtggttgaagatacaggccccggtatccccgaccaggcgctgacc
aaggtatttacgcgcttttattctcagcgtcccgacgagcattttggcaataactccggg
cttggcctcgcgatttccaagcagattgtcgaagctcatggtggcgtgatttgggctgag
aacattcgtcctaccgaagcggacatcacctccgagccgctgggtgcccggttcgttgtc
ggcttgccgatctga

DBGET integrated database retrieval system