KEGG   Sulfitobacter sp. SK012: C1J03_04635Help
Entry
C1J03_04635       CDS       T05563                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sulz  Sulfitobacter sp. SK012
Pathway
sulz00240  Pyrimidine metabolism
sulz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sulz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C1J03_04635
Enzymes [BR:sulz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C1J03_04635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 AAA_30
Motif
Other DBs
NCBI-ProteinID: AXI45386
UniProt: A0A345QJ99
LinkDB All DBs
Position
complement(917104..917691)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQAAHNYVERGMIPYLMTAHLDNRTGPAQIASRIGIAQPAD
TFAPGEDLFAKLKKRIAAGPCACVFIDEAQFLSEPQVWQLARAVDDLNLPIMCFGLRVDF
RGALFPGSATLLALADEMREVRTICHCGKKATMVVRQGSDGKALRDGAQVQIGGNETYVS
LCRRHWRKEVGDKPS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctttatttcaactattccaccatgaatgcaggcaaatccactgtcctgctg
caggctgcgcacaactatgtcgaacgcggcatgattccctatttgatgaccgcgcatctg
gacaaccggaccggtcctgcgcaaatcgcgtcccgtatcgggatcgcgcaacccgccgat
actttcgcgccgggtgaggatttattcgccaagttgaaaaagcggattgccgccggtccc
tgtgcttgcgtgttcatcgacgaggcacaatttttaagcgagccgcaagtttggcaactc
gcccgtgctgttgacgatctaaatttgccgatcatgtgctttggtttgcgggtggatttt
cgcggcgcgctgttccctggctctgccacattgctcgcgctggctgacgaaatgcgcgaa
gtgcgcacgatctgccattgcggcaagaaagcaaccatggttgtgcgccaaggatcagac
ggcaaagcgctacgggacggtgctcaagtgcaaatcggcgggaacgagacctacgtatct
ttgtgccgacgtcactggcgcaaagaggtcggggataaacccagctaa

DBGET integrated database retrieval system