KEGG   Sulfitobacter sp. SK012: C1J03_13990Help
Entry
C1J03_13990       CDS       T05563                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sulz  Sulfitobacter sp. SK012
Pathway
sulz00010  Glycolysis / Gluconeogenesis
sulz00020  Citrate cycle (TCA cycle)
sulz00620  Pyruvate metabolism
sulz01100  Metabolic pathways
sulz01110  Biosynthesis of secondary metabolites
sulz01120  Microbial metabolism in diverse environments
sulz01130  Biosynthesis of antibiotics
sulz01200  Carbon metabolism
Module
sulz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sulz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C1J03_13990
   00020 Citrate cycle (TCA cycle)
    C1J03_13990
   00620 Pyruvate metabolism
    C1J03_13990
Enzymes [BR:sulz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C1J03_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AXI47032
UniProt: A0A345QNZ5
LinkDB All DBs
Position
2870509..2871804
Genome map
AA seq 431 aa AA seqDB search
MPIEILMPALSPTMEEGTLAKWLVKEGDTVSSGDVMCEIETDKATMEFEAVDEGTIGKIL
IAEGTEGVKVNAAIAVLLEEGESVDDIGSSSAAAAPAETPNEAAVAAPAPSAAPAPSAPA
SSDGTRIFATPLARRIAADKGVDLAQVTGSGPHGRIVKADVEGLSKSDAPMAAAAPEAAA
PAATTLATGPSASAVAKMYEGREYEEVSLNGMRKIIASRLTEAKQSIPHFYLRRDIQLDA
LMAFRGQLNKQLEPRGIKLSVNDFIIKACALALQQVPDANAVWAGDRILKLKPSDVAVAV
AIEGGLFTPVLQDAEMKSLSALSAQMKDLAGRARDRKLAPHEYQGGSFAISNLGMFGIDN
FDAVINPPHGAILAVGAGVKKPVVGKDGELGVATVMSVTLSVDHRVIDGALGAELLNAIK
DNLEAPMTMLA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaaattctcatgcccgccctcagccccaccatggaagaaggcacattggcc
aaatggctggtcaaggagggcgataccgtgtcctccggcgacgtgatgtgcgaaatcgag
accgataaggccacgatggaattcgaggccgttgatgaaggcaccatcggcaagatcctg
atcgcagaaggcaccgaaggcgttaaagtgaatgccgccattgccgtccttctcgaagaa
ggtgaaagcgtcgatgacattggctcttcgtcggcagccgcggcaccagctgagacccca
aacgaagctgctgttgcagcgcctgctccaagtgcggccccggccccttctgcgccggca
agttctgatggaacgcgcatctttgccacgcctctggcccggcgcatcgctgccgacaaa
ggagtggatcttgcgcaagtaactggctctggtccgcatggtcggattgtcaaagctgat
gtagaaggcctgtcaaaatcagacgcacccatggccgcagcggcacccgaagctgctgca
cccgccgcaacaaccctcgcaaccgggccgtcagccagcgcggttgccaaaatgtacgag
gggcgcgagtacgaggaagtcagcctcaatggtatgcgcaaaatcatcgcctcgcgcctt
accgaagccaaacaatcgatcccgcatttctacctgcgccgggacatccagttggatgcg
ctgatggcgttccgtgggcagcttaacaagcaactcgaaccgcgtggcatcaagctgtcg
gtcaatgatttcataatcaaggcctgcgccttggcgcttcagcaagtaccagatgcgaat
gctgtttgggcgggcgaccgtatcctcaagctaaagccgtcggatgttgctgtggctgtc
gccatcgaaggtggtctgtttacaccggtccttcaggacgccgagatgaagtctctttcc
gcgctttcggcgcaaatgaaagacctcgcgggccgtgcgcgtgatcgcaagttggcaccg
catgaatatcagggcggcagttttgcgatctctaaccttgggatgtttggcatcgacaat
ttcgatgcggtcattaacccaccacacggcgcgatccttgctgtgggtgccggcgttaag
aagccagttgtcggcaaagatggtgagttgggtgtggcaacggtgatgtcagtcacgctt
tctgttgatcaccgtgtcatcgacggggcacttggcgcggaattgcttaacgcgatcaag
gacaacctcgaagcgccgatgaccatgctggcctag

DBGET integrated database retrieval system