KEGG   Sulfitobacter sp. SK012: C1J03_14645Help
Entry
C1J03_14645       CDS       T05563                                 

Definition
(GenBank) FMN-binding glutamate synthase family protein
  KO
K22083  methylamine---glutamate N-methyltransferase subunit C [EC:2.1.1.21]
Organism
sulz  Sulfitobacter sp. SK012
Pathway
sulz00680  Methane metabolism
sulz01100  Metabolic pathways
sulz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sulz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    C1J03_14645
Enzymes [BR:sulz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     C1J03_14645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_synthase FMN_dh NMO IMPDH ThiG DHO_dh His_biosynth QRPTase_C NanE G3P_antiterm PcrB
Motif
Other DBs
NCBI-ProteinID: AXI47144
UniProt: A0A345QPA7
LinkDB All DBs
Position
2999910..3001253
Genome map
AA seq 447 aa AA seqDB search
MKDDAPGAPRTTPIQSATFSNPVNAEIRRAAATGIYDIRGGGAKRKLPHFDDLLFLGASI
SRYPLEGYREKCETSVTLGTRFAKNPIQLDIPVTIAGMSFGALSGGAKEALGRGATLAGT
STTTGDGGMTEEERGHSNKLIYQYLPSRYGMNPDDLRRCDAIEIVVGQGAKPGGGGMLLG
QKISDRVAEMRNLPKGIDQRSACRHPDWTGPDDLEIKIMELREITNWEKPIYIKIGGARP
YFDTTLAIKAGADVVVLDGMQGGTAATQDVFIENVGQPILACIREAVRALQDLGMHREVQ
LIVSGGIRTGADVAKAMAMGADAVAIGTAALIALGDNDPKWEAEYNALGTTAGAYDDWHE
GKDPAGITTQDAELMKRFDPVEGGRRLNNYLKVMTLEAQTIARACGKNHLHNLEPEDLCA
LTMEAAAMAKIPLAGTDWYPGKPGTSY
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgacgccccgggcgcaccgcgcacgacgccgatccaatcggcaaccttcagc
aatccggtcaatgctgaaatccgccgtgcggcggccactggaatttatgatatccgcggt
ggcggagccaaacgtaagctccctcatttcgatgatttgctgtttcttggcgcatcgatt
tctcggtatcccctcgaaggctaccgggagaagtgcgaaacctccgtgacccttggcacc
cgttttgccaagaaccctattcagcttgatattccagtgacaattgctggcatgtccttt
ggggccctatctgggggcgcaaaagaagctctgggtcgtggtgcgacgcttgctggtaca
tcaacaacgaccggtgatggcggcatgaccgaagaagaacgcggccattccaacaagctg
atctatcagtacctgccctcgcgctatggcatgaaccccgatgatttgcgccgttgcgat
gcgattgagatcgttgtcggccaaggtgccaagcccggcggtggcggcatgctgttggga
caaaaaatcagcgaccgggtcgcagagatgcgcaacctgcccaaaggcatcgaccaacgc
tccgcgtgccgtcaccctgactggaccggcccagacgatcttgagatcaagatcatggag
ctgcgtgaaatcaccaattgggaaaagccgatctacatcaagattggcggcgcacgccct
tatttcgataccacgctcgccatcaaagctggcgctgatgtggtcgtgctggacggcatg
caaggcggcacggcggcgacgcaggatgtgttcatcgaaaacgttggtcagccgatcttg
gcgtgtatccgcgaagccgttcgcgcgctgcaggacctcggtatgcaccgtgaagttcag
ctgatcgtctctggcggcattcgcacaggtgcagacgtcgccaaggcgatggcaatgggc
gcagacgcagttgccatcggcaccgccgcgctgatcgcattgggcgacaatgaccccaag
tgggaagccgaatacaacgcacttggcactacagcaggcgcgtatgatgactggcacgag
ggcaaagaccccgcaggcattaccacgcaggacgcggagctgatgaagcgtttcgatccc
gtcgagggtggcaggcggttgaacaattaccttaaggtcatgacgctagaggcccaaacg
attgcaagggcgtgcggcaaaaaccatctgcataacctcgagccggaagacctgtgtgcg
ctgaccatggaagccgctgcaatggcgaaaatcccgctggcgggcactgattggtacccc
ggcaagccgggcacttcttactag

DBGET integrated database retrieval system