KEGG   Sulfurovum sp. NBC37-1: SUN_1220Help
Entry
SUN_1220          CDS       T00572                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00550  Peptidoglycan biosynthesis
sun01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sun00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SUN_1220
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SUN_1220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sun01011]
    SUN_1220
Enzymes [BR:sun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SUN_1220
Peptidoglycan biosynthesis and degradation proteins [BR:sun01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SUN_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BAF72174
UniProt: A6Q9L5
LinkDB All DBs
Position
complement(1255351..1257285)
Genome map
AA seq 644 aa AA seqDB search
MRYKITLLLFILVWAAMITRLYHVSVKSNFYYEGLAKANIERKEYIKPVRGEITDRNGNL
LAMNQIGFSLSIKPHLSTKNVEGKKSQLEQAVDILIETFPDLNKTMMMKVYKKKSSPYNH
KYIKVVDFLHYADMMGAYPRLSMFDDIKIEAETKRYYPYGRYAAHLIGYTGRSNAKENES
DEVVDVVGKVGKSGLEKYYNSFLQGELGYQVNKVTARNKAIDVLEKMLPKDNRNLELNID
IDLQKMIYEHFGDATGVAIVMRTTGEIIAAVSYPAYDPNLFVGGISSKDWKALQEDLAHP
FTNKITHGTYPPGSSIKPGMAMAFDKAKPGILEKSEYCKGYMTIGNSKHKFRCWKHSGHG
TVYLRKAIMQSCDVYFYKKSLQVGIDAMAKNLRSFGLGVKTGVDLPREYNGVIPDKAWKM
KRFKKSWFLGETVIAAIGQGYDLVTPLQVARYTALIATGNLVTPRVAKRINGVDINMTSV
PIKFNPISISEVRKGMYDVCNIPHGTAYRLMHDLPIKVAGKTGTSQVTSIPQGMGKRLKE
SELAYFHRSHAWITTYAPYDNPQYVVTVLIEHGGHGGSTSAPMAGDIYRWLYKNNYFTSK
LQKNIDTAVGTEQMESVEVQKKKEKIRKRNEELRKKSSEGLSLF
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagatataagataacactgctgcttttcatactggtatgggcagcgatgatcactcgg
ctctatcatgtaagtgtcaaatcaaacttctattatgaaggacttgccaaggcaaacata
gagagaaaagagtatatcaaacctgtaagaggagagatcaccgatcgtaacgggaatctt
ctggcaatgaaccagatcgggttctctctatcgataaaaccgcatctttccacgaagaat
gtcgaggggaagaagagccagttagagcaggcagtggatatcctgattgaaaccttcccc
gacctgaacaaaacaatgatgatgaaagtatataaaaagaagagttctccctacaatcac
aaatacatcaaagtggtcgatttcctacactatgcggacatgatgggggcatacccaagg
ttaagtatgtttgatgatatcaaaatagaagcagagacgaaacgatactacccctatggc
agatacgcagcccatctcatagggtataccggaaggtcaaatgccaaagaaaatgaatca
gatgaagtggtcgatgttgtcgggaaagtgggtaaaagcgggcttgaaaagtattacaac
agtttccttcagggtgaactgggataccaggtcaacaaggtgaccgcgaggaacaaggcc
attgatgtccttgaaaaaatgctacccaaagacaatagaaaccttgagctcaatatcgat
attgacctgcaaaagatgatctatgaacactttggtgatgcgaccggtgtggcaatcgtg
atgcgaacaacgggtgagatcattgcagcggtgagttatcctgcttatgatccgaatctt
tttgtcggagggatcagctcaaaggactggaaagcgctgcaggaagacctggcacatcct
tttaccaacaagatcacccacgggacctatcctcctggatcttccattaagccgggaatg
gccatggcatttgacaaggccaagccgggtattttggagaagagcgaatactgtaaaggc
tacatgaccatcgggaacagtaaacataaatttcgatgctggaaacatagtggtcatggt
acggtatatctgcgtaaagcgatcatgcagagctgtgacgtttacttttacaagaaaagc
cttcaagtggggattgatgcgatggcgaaaaatcttcgctcattcggtctgggagtgaaa
actggtgtagaccttccaagagaatacaacggtgttataccggacaaagcatggaaaatg
aagcgattcaagaaatcatggttcttaggagaaacggtcattgctgctatcggacagggg
tatgaccttgtcacgccacttcaggtagcacgctatacggcattgatagccacgggtaat
cttgttacaccacgtgtggcaaagcgtatcaacggtgtagatatcaatatgacaagtgtt
ccaataaaattcaacccgatatctatctctgaggtacgtaaaggaatgtacgatgtctgt
aatattccacatggtacagcgtacagacttatgcatgatcttcctattaaagtagcgggc
aagacaggtacatcccaggtgacatccataccacagggaatggggaagaggctcaaagaa
tccgaactggcctacttccaccgttcccatgcttggatcacgacctatgccccctatgac
aatccgcaatacgttgtaacggtcctcatcgagcatggcggccacggtggtagtacctct
gcacctatggcgggagatatctaccgttggctgtataagaacaattatttcacgagcaag
ctgcaaaaaaatattgatacagcggtcggaacagaacagatggaaagtgttgaagtacag
aagaaaaaagagaagatcagaaaacgaaatgaagagctcagaaagaagagcagcgaggga
ctgtcactcttttaa

DBGET integrated database retrieval system