KEGG   Sulfurovum sp. NBC37-1: SUN_2213Help
Entry
SUN_2213          CDS       T00572                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sun00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SUN_2213
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sun03400]
    SUN_2213
Enzymes [BR:sun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SUN_2213
DNA repair and recombination proteins [BR:sun03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SUN_2213
 Prokaryotic type
     SUN_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG NOP5NT
Motif
Other DBs
NCBI-ProteinID: BAF73153
UniProt: A6QCE4
LinkDB All DBs
Position
complement(2310403..2311104)
Genome map
AA seq 233 aa AA seqDB search
MPSNSWEKILQEAYGELEEAYRSFLEKDSGYIPNRENYLNAFKTLPREKVKYILFGQDPY
PRMESASGYAFIDAKVKEIFSDKGLSKEVNRATSLRNFVKMALVARGDLSLEDLSQDAIA
AIDKTSLISSIRELRINFEKNGVLLLNTALVFTDKKSSTRHVKAWRPFVQSLLKALEAQQ
PKLILFGTHAKELKKKLPLENFESIELEHPYNHTFISNPRALALFGPMHLLDK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctaacagctgggagaagattcttcaggaggcgtatggagaacttgaggaggcg
tatcgctcttttcttgaaaaagacagcgggtatatcccgaacagagaaaactacctgaat
gccttcaagacactgcccagagagaaggtaaaatatatccttttcggtcaggatccctat
ccccggatggagagtgccagcggctatgctttcatcgatgcaaaagtaaaggagatattt
tccgacaaaggattgagcaaagaagtgaaccgggcaacgagtttgcgtaatttcgtcaag
atggcattggtggcacggggcgatctttctttggaagatctttcacaggatgctattgca
gcgatagacaaaacatcccttatctcctctatccgggagctcaggatcaattttgaaaag
aacggcgtcctgctgcttaataccgctctggtctttacggataagaaaagttcgaccaga
catgtcaaagcctggcggcccttcgtgcagagcctcctgaaggcccttgaagcacagcag
ccaaagctcatccttttcggaacccacgccaaagagctgaaaaagaagctgccgcttgaa
aacttcgagtcgattgagctggagcatccctataaccatacgttcatcagtaatccaaga
gcgcttgcccttttcggcccgatgcacttacttgataaataa

DBGET integrated database retrieval system