KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_0487Help
Entry
SSU12_0487        CDS       T02025                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00620  Pyruvate metabolism
suo00680  Methane metabolism
suo01100  Metabolic pathways
suo01120  Microbial metabolism in diverse environments
suo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSU12_0487
  Energy metabolism
   00680 Methane metabolism
    SSU12_0487
Enzymes [BR:suo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SSU12_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RasGEF
Motif
Other DBs
NCBI-ProteinID: AER14678
LinkDB All DBs
Position
510355..513051
Genome map
AA seq 898 aa AA seqDB search
MAIQKLENYNNKEAIREEVTILTSILEEVAAQMMPAETFAKIVELSQLSRQDDYQALIAI
ISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNIDQDYLGKISTTIDMVSKQE
NAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRRYRDVKLGLLNKNKWEDELRC
YIEIIMQTDMIREKKLKVTNEITNVMEYYNSSFIKAVTKLQREYKRLAAEKGIVLNNPRP
ITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNYYDEQLYKLYRNFSLSTSIVNVSTA
VKMLADLSEDSSVYRENEPYRRAFHYIQMKLANTRDYLVHNKPSDVRYSNVAEFKADLLA
IKQSLVENKSMALLKGDFTELLEAVEAFGFYLASIDMRQDSSIHEASVAELLASARIVED
YSSLSEEAKCHVLLKQLETDPRILSATHMPKSEQLEKELAIFAAARELKDKLGEEIIKQH
IISHSESVSDLLELAVLLKEVGLVDVDKARVQIVPLFETIEDLDNAPDTMRQYLQLDLAK
RWIAGNKYYQEIMLGYSDSNKDGGYLSSGWTLYKAQNELTQIGQDYGVNITFFHGRGGTV
GRGGGPSYDAITSQPFGSIKDRLRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTQ
MITDPNEIDGYRETMDEIVSDSYRIYRDLVFNNPHFYDYFFAASPIREVSSLNIGSRPAA
RKTITEIGGLRAIPWVFSWSQNRVMLPGWYGVGSSFKRFIDKHPDNLSKLQKMYESWPFF
RSLLSNVDMVLSKSNMNIAFEYAKMCESEEVRNIFHVILDEWQLTKEIILSIEQNDELLA
ELPFLKASLDYRMPYFNVLNYIQIELIHRLRRGELSKEQENLIHITINGVATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaaaaattagaaaactataacaacaaggaagcaatccgtgaagaagtaacg
attctaacatctattttggaagaagtagcagcccaaatgatgcctgcagagacttttgct
aaaattgtagaactatctcaattgtctcgtcaagatgattatcaggcattgattgctatt
atcagtcagttgaataatgatgaactagcggttatttctcgatactttgctgttttgcca
cttttgattaatatatcagaagatgttgacttggcctatgaaatcaaccatcaaaacaat
attgatcaagattatcttggtaagatttcaacaacaattgatatggtttccaaacaagaa
aatgcagctgaaatccttgaaaagttgaatgttgttccagtcttgacagcccatcctact
caggttcaacgccagtctatgcttgatttaaccaagcatattcatgagttgcttcgtcgt
tatcgcgatgtaaaattgggcttgctcaataaaaacaaatgggaagatgagctccgttgt
tacattgaaattatcatgcagacggatatgattcgtgagaagaagttgaaggtaaccaac
gaaatcacaaacgttatggagtattacaattcttcctttattaaggctgtcactaagttg
cagcgggaatacaaacgtttggccgctgagaaaggaatcgtcttaaataatcctcgtcca
attacaatgggtatgtggattgggggagaccgtgatggaaatccatttgttactgcagag
accttgaagctgtcagccttgactcagtgtgaagtcattatgaattattacgatgagcaa
ctctataaactctatcggaatttttcgctctcaacttccattgtaaatgtatctacagcg
gttaagatgctggcggatttatctgaagatagttctgtctaccgtgaaaatgagccttat
cgtcgtgcttttcactatattcagatgaaacttgcaaatacaagagattatttagttcac
aataagccgtcagatgttcgctatagtaatgtagccgagtttaaagctgatttattagcc
atcaaacaatctttggtcgaaaataaatctatggcgctattgaaaggtgattttacagaa
ttgcttgaagcggttgaagcgtttggtttctacctagctagtatcgatatgcgccaagac
tcttctattcatgaagcaagtgttgcggagttattggcctctgctcgtatcgtagaagac
tactccagtttatctgaggaagctaaatgccatgttcttttgaaacagttggaaacagat
ccacgcattctttctgcaacgcacatgccaaagtcagaacaattagaaaaagaattggca
atctttgctgctgcacgtgaattgaaagataagctaggtgaggaaatcatcaagcaacat
attatttcacactcggagagtgtttctgatttactggaattagctgtcctattaaaagaa
gttggtctagtagatgtcgataaggcccgtgttcagattgttccactttttgagacaatc
gaggatttagataatgcacctgataccatgcgtcaatatctgcaattagatttagcgaaa
cgttggattgcaggcaataaatactaccaagaaatcatgcttggctactcagattccaac
aaggatggtggctacctatcctccggctggacactctacaaagcacagaatgaattgacg
caaattggtcaagactacggagtaaacatcaccttcttccacggtcgtggaggtactgtt
ggtcgtggtggtggtccttcctatgatgcgattacatctcagccatttggttccatcaag
gaccggcttcgtttgacagaacaaggcgaagtgataggcaataaatacggtaacaaagac
gcagcctactataatttagaaatgctggtatctgcaacgcttgaccgtatggtcacacaa
atgattaccgatccaaatgaaatcgatggctatcgcgaaaccatggatgaaattgtatca
gatagctatcgtatttatagagatcttgtattcaacaatccacatttttatgattatttc
tttgccgctagtccaattcgtgaagtatcaagtctgaacattggctcacgtcctgcggct
cgaaaaaccatcacagaaatcggtggtttgcgtgcgatcccatgggtattctcttggtca
caaaaccgtgtcatgttgccagggtggtatggagttggttcaagtttcaaacgctttatt
gataagcaccctgataatttgtctaagttacaaaaaatgtatgaatcttggccattcttc
cgttcacttctatcaaacgtggatatggtattgtctaaatccaatatgaatatcgcattt
gaatatgctaaaatgtgtgaaagcgaagaggtacgaaatatcttccatgtcattttagat
gaatggcagttgaccaaagaaattattttgtcaatcgagcaaaatgatgagcttttagca
gaactaccgtttctaaaagctagtcttgattatcgcatgccttattttaatgtgctcaac
tatattcagattgaattaattcatcgtcttcgtcgtggagaattgagcaaagaacaagag
aatctcattcatattaccatcaatggtgtggcgacaggtttgcgcaactcaggttaa

DBGET integrated database retrieval system