KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_0789Help
Entry
SSU12_0789        CDS       T02025                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00240  Pyrimidine metabolism
suo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSU12_0789
Enzymes [BR:suo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SSU12_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30 AAA_22 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AER14976
LinkDB All DBs
Position
822042..822623
Genome map
AA seq 193 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDAFGVVSSRIGMRRDAV
AIDDDMDIFGFIEKMEPRPYCVLIDEAQFLRRHHVYALARVVDELDVPVMAFGLKNDFRN
ELFEGSQHLLLLADKLDEIKTICQYCSKKATMVLRTQDGKPTYEGEQIQIGGNETYIPVC
RKHYFSPEIKDLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaattatattataaatatgggacaatgaactcaggaaaaaccattgagattttg
aaggttgcccacaactatgaagaacaaggaaaacctgttgttatcatgacatctgcactt
gatactcgtgatgcctttggtgttgtatccagtcgtataggcatgagaagagatgcagtg
gcgattgacgatgatatggatatctttggttttattgaaaaaatggaaccgcgtccttac
tgtgttctcattgatgaagcacaatttcttcgacgtcatcacgtctacgcacttgctcgc
gtagtcgatgaattagatgtacccgttatggctttcggtcttaaaaatgatttccgaaat
gaactatttgaaggttcccaacatttgctcttattggctgataaattagatgaaatcaaa
acaatctgccaatattgttctaaaaaagcgacaatggttttgagaacacaggatggaaaa
cctacttatgaaggagaacaaatccaaattggtggcaatgaaacctacattcctgtctgt
cgcaaacattatttttcaccagaaattaaagatttaccctaa

DBGET integrated database retrieval system