KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_1382Help
Entry
SSU12_1382        CDS       T02025                                 

Definition
(GenBank) 3-carboxymuconate cyclase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00030  Pentose phosphate pathway
suo01100  Metabolic pathways
suo01110  Biosynthesis of secondary metabolites
suo01120  Microbial metabolism in diverse environments
suo01130  Biosynthesis of antibiotics
suo01200  Carbon metabolism
Module
suo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:suo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSU12_1382
Enzymes [BR:suo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     SSU12_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase
Motif
Other DBs
NCBI-ProteinID: AER15561
LinkDB All DBs
Position
1412687..1413691
Genome map
AA seq 334 aa AA seqDB search
MAIYFGTYTKRESKGIYKANFDSETGQLSNLELVTEEPNPTYLAFDKAGHLYSVGAENGL
GGIAAFNTDYTLLNHVVSEGAPLCYVAVDEARDLVYGSNFHKGQLLVYKRLADGSLELAD
VAQHEGSGPHENQASAHVHFSDLTPDKFLVTCDLGCDQVVTYKVSDQGKVEKIATYQAAP
GSGPRHIVFHTVAKIAYLICELNSTIEVLIYDGWGQFEHLQTVSTLPEDHTGFNGTAAIR
ITKDGKFIYGSNRGNDSIAVYKTLADASLELVEIVPTNGKTPRDFTLSPDEKHLIVVHQD
SDNATVFKRDAENGCLTELSHDFYVPEAVCVTFL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggctatctatttcggtacctatacaaaacgtgaatcaaaaggaatttataaagcaaat
tttgactctgaaacaggacaacttagcaatctagaattggtcactgaagaacctaaccct
acctaccttgcctttgataaggccggacatctatactccgtcggcgctgaaaatggtcta
ggaggtatcgctgcctttaatactgactatactctactcaaccatgttgtatcagagggc
gcaccactttgctatgtcgctgtagatgaagcaagagatttagtttatggttccaatttc
cacaaagggcaactacttgtttataaacgtttggcggatggttcgctagaattagctgat
gtcgctcaacacgaaggatctgggccgcacgaaaaccaagcttccgcccacgttcacttt
tctgatttgacgcccgataaatttttagtaacctgtgatttaggatgtgatcaagtggta
acctataaggtatctgaccaaggaaaagtagagaaaatagcaacctatcaggctgcgcca
ggaagtggtccacgtcacattgtcttccatactgtcgcaaaaatcgcctatctcatctgt
gaactcaattcaactattgaggtgcttatctacgacggctggggacaatttgaacaccta
caaactgtctctactctcccagaagaccatactggtttcaacggtactgccgctattcgc
atcacaaaggatggtaaatttatttatggatccaaccgcggaaacgactctatcgcagtc
tacaaaacgcttgctgatgccagcttagaattagttgaaatcgtcccaacaaatggaaaa
actcctcgcgatttcacgcttagtcctgatgaaaagcatttgattgttgtccatcaagat
tctgacaatgcaactgtattcaaaagagatgccgaaaatggctgtttgactgagctttca
cacgatttctatgttcctgaagcagtttgcgttacatttttataa

DBGET integrated database retrieval system