Streptococcus suis SS12 (serotype 1/2): SSU12_1743 Help Entry SSU12_1743        CDS       T02025                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism suo  Streptococcus suis SS12 (serotype 1/2) Pathway suo01100   Metabolic pathways suo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:suo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SSU12_1743 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SSU12_1743 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  AER15920 LinkDB All DBs Position complement(1715205..1715429) Genome browser AA seq 74 aa AA seqDB search MAVFEKVQEIIVEELGKDAEEVTLTTTFEDLDADSLDLFQVISEIEDAFDIQIDTEEGLT TVGDLVAYVEEKTK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaaaaagtacaggaaatcatcgttgaagaattgggtaaggatgctgaa gaagtaactcttacaacaacctttgaggatttggacgcagattcattggatcttttccaa gttatctctgaaatcgaagatgcattcgacatccaaatcgacactgaagaaggtttgact actgtaggcgatttggttgcttatgttgaagaaaaaacaaaataa

DBGET integrated database retrieval system