KEGG   Streptococcus suis S735 (serotype 2): YYK_01505Help
Entry
YYK_01505         CDS       T02214                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sup  Streptococcus suis S735 (serotype 2)
Pathway
sup00220  Arginine biosynthesis
sup00250  Alanine, aspartate and glutamate metabolism
sup00290  Valine, leucine and isoleucine biosynthesis
sup01100  Metabolic pathways
sup01110  Biosynthesis of secondary metabolites
sup01130  Biosynthesis of antibiotics
sup01210  2-Oxocarboxylic acid metabolism
sup01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YYK_01505
   00290 Valine, leucine and isoleucine biosynthesis
    YYK_01505
   00220 Arginine biosynthesis
    YYK_01505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sup01007]
    YYK_01505
Enzymes [BR:sup01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     YYK_01505
    2.6.1.66  valine---pyruvate transaminase
     YYK_01505
Amino acid related enzymes [BR:sup01007]
 Aminotransferase (transaminase)
  Class I
   YYK_01505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFQ99819
LinkDB All DBs
Position
334409..335623
Genome map
AA seq 404 aa AA seqDB search
MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAEFGFTAPDEVIRDLIH
NARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLADMESKVTSRTKAIVLINPNNP
TGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGAVHIPIATLAPDLFVVTMNGLSK
SHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
MPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDREMYRVEDDEQFVLDFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaacaagtcaacaaaattggatgatgtagcatatgatattcgtgggcct
gttttggaagaggccatgcgcatgcgtgccaatggagagcagattttacgtttgaatacg
gggaatcctgcagaatttggttttactgctccagatgaagttattcgtgacttgattcat
aacgcccgtaaatcagagggatattcgaacagtaagggaattttttctgcacgtaaggct
atcatgcagtattgtcagctaaagaaatttccaaatgttgacattgaagatatttatctt
ggaaacggcgtgagtgagctgattgttatgtctatgcaaggtttgctagataatggtgat
gaggtgttggtgccaatgccagactatcctctctggactgctgcagttagtttggctggt
ggtaaagctgttcactatgtttgtgatgaagtagctgaatggtatccagatttggcagat
atggagtccaaggtgacttctcgaaccaaggcaattgtccttatcaatccaaataatcca
actggtgctctctatccgaaagaaattttaaaaggaatcattgatattgctcgtagacat
gaattgatcattttctctgatgagatttatgatcgtatggtctttgatggagctgttcat
atccctattgcgacactggctccagatttatttgttgtgacgatgaatggactgtctaaa
tcacatcgtatttgtggtttccgagtaggttggatggtcttatctggtccgaaaaagcat
gtaaaaggttacattgaaggcttgaatatgttgtccaatatgcgtttgtgttcaaacgtt
ttggctcaacaggttgttcaaacttctttgggaggttaccaatcggttgatgagctcttg
atgcctggcggacgcttatatgaacaaagggagttcattaccaaggcgattaatgatatt
ccgggactttctgctgtaaaacctaaggctggtctgtatgtattcccaaaaattgatcgt
gagatgtacagagttgaggatgatgaacaatttgtattggatttcctcaagcaagaaaaa
gtacttttggtccatggtcgaggttttaactggaaggatccagatcatttccgtattgtg
tatttaccacgtgttgatgagttggcagaaattcaagaaaaaatgtcacgattcttgcgg
caatatcgtagataa

DBGET integrated database retrieval system