KEGG   Streptococcus suis S735 (serotype 2): YYK_07845
Entry
YYK_07845         CDS       T02214                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sup  Streptococcus suis S735 (serotype 2)
Pathway
sup00010  Glycolysis / Gluconeogenesis
sup00020  Citrate cycle (TCA cycle)
sup00620  Pyruvate metabolism
sup01100  Metabolic pathways
sup01110  Biosynthesis of secondary metabolites
sup01120  Microbial metabolism in diverse environments
sup01200  Carbon metabolism
Module
sup_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YYK_07845
   00020 Citrate cycle (TCA cycle)
    YYK_07845
   00620 Pyruvate metabolism
    YYK_07845
Enzymes [BR:sup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YYK_07845
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: AFR01080
LinkDB
Position
complement(1622693..1624081)
AA seq 462 aa
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPVAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggcgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgctgaaggt
gaaacggttgaagccggcgcttcatctgctcctgctgttgaaccagcagcggctattgaa
gaagtacctgcgggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtagtggcaaggtgcgtgcaacgccagctgcgcgtaaattggcgcgtgagcttggaatc
gacttgggtcttgttccaggaacaggtgctaacggtcgtgtccacaaggttgacgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcagaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaacgac
gttcttgcagtacttgctcctgtagctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgaccaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcggttgttcgtact
ttgatgaaagaagaacaccgttacatgaacgcatctttgattaacgatgcacaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttggtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaactgttcaaacaccagttgttattgacggcgaa
atcaagatccgtccaatcatggcactctgcttaaccatcgaccaccgtatcattgatggt
atgaatggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatctga

DBGET integrated database retrieval system