KEGG   Streptococcus suis S735 (serotype 2): YYK_07855
Entry
YYK_07855         CDS       T02214                                 

Definition
(GenBank) pyruvate dehydrogenase E1 component subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sup  Streptococcus suis S735 (serotype 2)
Pathway
sup00010  Glycolysis / Gluconeogenesis
sup00020  Citrate cycle (TCA cycle)
sup00620  Pyruvate metabolism
sup01100  Metabolic pathways
sup01110  Biosynthesis of secondary metabolites
sup01120  Microbial metabolism in diverse environments
sup01200  Carbon metabolism
Module
sup_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YYK_07855
   00020 Citrate cycle (TCA cycle)
    YYK_07855
   00620 Pyruvate metabolism
    YYK_07855
Enzymes [BR:sup01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     YYK_07855
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Other DBs
NCBI-ProteinID: AFR01082
LinkDB
Position
complement(1625704..1626672)
AA seq 322 aa
MVSITKEQHLDMFLKMQQIRDVDMKLNKLVRRGFVQGMTHFSVGEEAAAVGPIAGLTDED
IIFSHHRGHGHVIAKGIDINGMMAELAGKATGTSKGRGGSMHLANVEKGNFGSNGIVGGG
YALAVGAALTQQYLGTDNIVIAFSGDSATNEGSFHESMNLAAVWNLPVIFFITNNRYGIS
TDISYSTKIPHLYQRAAAYGIPGHYVEDGNDVIAVYEKMQEVIEYVRAGKGPAMVEVESY
RWFGHSTADAGVYRTKEEVNEWKAKDPLKKYRKYLTENKIATDEELDAIEAQVAEQVEAS
VKFAQESPDPDISVAYEDVFVD
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtatctatcacaaaagaacaacatttggacatgttcttgaaaatgcaacaaatccgt
gatgttgacatgaaattaaacaaattagtgcgtcgcggtttcgtacaaggtatgactcac
ttctcagtcggtgaagaagctgcggctgttggacctattgctggattgacagatgaggac
atcatcttctcacaccaccgtggtcacggtcacgttattgcaaaaggtattgacatcaac
ggcatgatggctgagcttgctggtaaggcaacaggtacatctaaaggtcgtggtggttcg
atgcacttggctaacgttgaaaaaggaaactttggttcaaacggtatcgtaggtggtggt
tatgcccttgcggtgggtgcggcccttacgcaacaatacctcggtacagataacattgtt
attgccttctcaggtgattcggctactaacgaaggttccttccacgaatcaatgaacttg
gcagctgtttggaacttgccagttatcttcttcattacaaacaaccgttacggtatttca
actgacatttcttattctactaagattcctcacctctaccaacgtgctgctgcatacggt
attccaggtcattatgttgaggatggtaacgacgttattgctgtttatgaaaaaatgcaa
gaagtcatcgagtacgttcgtgcaggtaaaggtccagccatggtcgaagttgaatcatac
cgctggtttggtcactcaactgccgatgcaggtgtttaccgtactaaagaagaagtcaat
gagtggaaagcaaaagacccacttaagaaataccgcaaatacttgacagaaaacaagatt
gcgacagacgaagaattggatgccatcgaagcacaagtcgcagaacaagtagaagcatct
gtgaaattcgcacaagaaagcccagatccagacatctcagtagcttatgaggatgtgttt
gtagactag

DBGET integrated database retrieval system