KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_10253Help
Entry
HMPREF0772_10253  CDS       T01889                                 

Definition
(GenBank) GroES-like protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00040  Pentose and glucuronate interconversions
suq00051  Fructose and mannose metabolism
suq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0772_10253
   00051 Fructose and mannose metabolism
    HMPREF0772_10253
Enzymes [BR:suq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     HMPREF0772_10253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 PrmA Methyltransf_25 2-Hacid_dh_C Methyltransf_31 UDPG_MGDP_dh_N DUF4179
Motif
Other DBs
NCBI-ProteinID: ADQ75715
LinkDB All DBs
Position
complement(263997..265040)
Genome map
AA seq 347 aa AA seqDB search
MKALKLYGVEDLRYEDNEKPVIESANDVIVKVRATGICGSDTSRYKKMGPYIQGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDIAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttgaaattatatggcgtggaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattgttaaagtacgagcgactggaatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattcaaggtatgccatttggtcatgaa
ttttcaggtgttgtagatgccattggaagtgatgttacgcatgttaatgtaggcgacaaa
gtgacaggttgcccagccataccttgttatcaatgcgagtattgtttaaaaggtgaatat
gcacgatgtgaaaagttgttcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggtaccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggattgttagctattcaatgggca
cgaatatttggtgctgcgcatatcatcgctatagatatagatgcgcataaactagatatt
gctacatcattgggcgcacatcaaaccatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatatagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccggggaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag

DBGET integrated database retrieval system