KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11866Help
Entry
HMPREF0772_11866  CDS       T01889                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00030  Pentose phosphate pathway
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
suq01120  Microbial metabolism in diverse environments
suq01130  Biosynthesis of antibiotics
suq01200  Carbon metabolism
suq01230  Biosynthesis of amino acids
Module
suq_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:suq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0772_11866 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    HMPREF0772_11866 (tkt)
Enzymes [BR:suq01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     HMPREF0772_11866 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: ADQ77328
LinkDB All DBs
Position
complement(1981046..1983034)
Genome map
AA seq 662 aa AA seqDB search
MFNEKDQLAVDTLRALSIDTIEKANSGHPGLPMGAAPMAYTLWTRHLNFNPQSKDYFNRD
RFVLSAGHGSALLYSLLHVSGSLELEELKQFRQWGSKTPGHPEYRHTDGVEVTTGPLGQG
FAMSVGLALAEDHLAGKFNKEGYNVVDHYTYVLASDGDLMEGISHEAASFAGHNKLSKLV
VLYDSNDISLDGELNKAFSENTKARFEAYGWNYLLVKDGNDLEEIDKAITTAKSQEGPTI
IEVKTTIGFGSPNKAGTNGVHGAPLGEDERKLTFENYGLDPEKRFNVSEEVYEIFQNTML
KRANEDESQWNSLLEKYAETYPELAEEFKLAISGKLPKNYKDELPRFEFGHNGASRADSG
TVIQAISKTVPSFFGGSADLAGSNKSNVNDATDYSSETPEGKNVWFGVREFAMGAAVNGM
AAHGGLHPYGATFFVFSDYLKPALRLSSIMGLNATFIFTHDSIAVGEDGPTHEPIEQLAG
LRAIPNMNVIRPADGNETRVAWEVALESESTPTSLVLTRQNLPVLDVPEDVVEEGVRKGA
YTVYGSEETPEFLLLASGSEVSLAVEAAKDLEKQGKSVRVVSMPNWNAFEQQSEEYKESV
IPSSVTKRVAIEMASPLGWHKYVGTAGKVIAIDGFGASAPGDLVVEKYGFTKENILNQVM
SL
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatgaaaaagatcaattagctgttgatacgctacgtgcactaagtatcgacaca
atcgaaaaagcgaattctggtcatccaggattacctatgggagctgccccaatggcttac
actttgtggacacgtcatctgaattttaatccacaatctaaagattacttcaatagagac
cgtttcgtattatctgcagggcatggttcagcactattgtatagcttgttacatgtttct
ggtagtttagaattagaagaattaaagcaatttagacaatggggttctaaaacaccaggt
catcctgaatacagacatacagatggtgtagaagttactactggaccacttggacaaggt
tttgctatgtcagttggattggctttagcagaagatcacctagcagggaaatttaataaa
gaaggatataatgttgtagatcattacacatatgtattagcttctgacggtgatttaatg
gaaggtatttcgcatgaagcagcttcatttgctggacataataaattaagtaaattagtt
gttttatacgattcaaatgatatttcattagatggcgaattaaacaaagctttttctgaa
aacacaaaagctcgttttgaagcatatggttggaattacttactagttaaagatggtaat
gatttagaagaaattgataaagcgattactacagctaaatctcaagaaggaccaacaatt
attgaagttaaaacaacaatcggatttggttcaccgaataaagcaggaactaatggtgtt
catggggcacctttaggtgaagatgaaagaaaattaacattcgaaaattacggtttagat
cctgaaaaacgttttaatgtttcagaagaagtatacgaaattttccaaaatactatgtta
aaacgtgctaatgaagatgaatctcaatggaattcattattagaaaaatatgcagaaaca
tatcctgaattagcagaagaatttaaattagcgattagtggtaaattgcctaaaaattat
aaggatgaattaccacgttttgaatttggtcataatggtgcatctcgtgctgattctggt
actgttattcaagcaatcagtaaaactgtcccttcattctttggtggatcagcagacctt
gctggttcaaacaaatccaatgtaaatgatgcaacagattatagttctgaaacacctgaa
ggtaaaaatgtgtggtttggtgtacgtgaatttgctatgggtgctgctgtaaatggtatg
gctgcacatggaggtttacatccatatggtgcaacattcttcgtatttagtgattattta
aaaccagcgttacgtttatcatcaattatgggattaaatgcaacgttcatcttcacgcat
gattcaattgcagtaggtgaagatggtcctactcatgaaccaattgaacaattagctgga
ttaagagccattccaaatatgaatgttatccgtcctgctgatggtaatgaaacaagagta
gcatgggaagttgccttagaatctgaatctacacctacttcattagtattgacacgtcaa
aacttaccggttttagatgtaccagaagatgtagttgaagaaggcgttcgaaaaggtgcc
tatacagtttatggctctgaagagacaccagaatttctattattagcttcaggttcagaa
gttagtcttgcagttgaagctgctaaagatcttgaaaaacaaggtaaatcagtgcgtgtt
gtttcaatgcctaactggaatgcatttgaacaacaatctgaagaatataaagaatcagtt
attccatcaagcgtaacaaaacgtgttgcgattgaaatggcttcaccgcttggatggcat
aaatatgtaggtactgcaggtaaagttattgctattgacggctttggcgcaagtgcacct
ggcgatttagtagttgaaaaatatggctttacaaaagaaaatatcttaaaccaagttatg
agcttataa

DBGET integrated database retrieval system