KEGG   Staphylococcus aureus subsp. aureus TCH60: HMPREF0772_11878Help
Entry
HMPREF0772_11878  CDS       T01889                                 

Gene name
thrB
Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
suq  Staphylococcus aureus subsp. aureus TCH60
Pathway
suq00260  Glycine, serine and threonine metabolism
suq01100  Metabolic pathways
suq01110  Biosynthesis of secondary metabolites
suq01120  Microbial metabolism in diverse environments
suq01230  Biosynthesis of amino acids
Module
suq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:suq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0772_11878 (thrB)
Enzymes [BR:suq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     HMPREF0772_11878 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF3963
Motif
Other DBs
NCBI-ProteinID: ADQ77340
LinkDB All DBs
Position
complement(1992904..1993863)
Genome map
AA seq 319 aa AA seqDB search
MIKIALSIILKELYNMSNVLELTIPASTANLGVGFDSIGMALDKFLHLSVKETSGTKWEY
IFHDDASKQLPTDETNFIYHVAQQVAAKYSVDLPNLCIEMRSDIPLARGLGSSASALVGA
IYIANYFGDIQLSKHEVLQLATEIEGHPDNVAPTIYGGLIAGYYNDVTKETSVAHIDIPD
VDVIVTIPTYELKTEASRRALPQKLTHSEAVKSSAISNTMICALAQHNYELAGKLMQQDG
FHEPYRQHLIAEFDEVKTIASQHNAYATVISGAGPTILIFSRKENSGELVRALNRNVVTC
HSELVDINVSGVKERIVYQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgataaagatagcattatcgattatattaaaggagctttataacatgtcgaatgttttg
gagttaacaattcctgcatcaacagccaaccttggagttggctttgattctataggtatg
gctttagataaatttttgcatctgtctgtaaaagaaacatcagggacaaaatgggaatat
attttccatgatgatgcatcgaagcaattacctactgacgaaacaaactttatttatcat
gtggcacaacaagttgctgctaaatatagtgttgacttgcctaatttatgtatcgaaatg
agaagtgatattccattggcaagagggttaggttcgtcagcttctgctttagtaggagct
atatatatcgcaaattattttggtgatatccaactatctaaacacgaggtattacaatta
gcgactgaaatcgaaggacatcctgataatgttgcgccgaccatttatggtggtttaatc
gctggatattataatgatgtcacgaaagaaacgtcagttgcacatatcgacataccagac
gtggatgtgattgtaacgataccaacttatgaactaaaaacagaagcatcaagacgtgct
ttaccacaaaaattaacacatagtgaagccgttaaaagtagtgcaattagtaatacaatg
atttgtgcattagcacagcacaattatgaattagcaggtaaactcatgcaacaagatggc
tttcatgaaccgtatcgtcagcatttaattgctgaatttgatgaagtgaaaacaattgct
agtcaacataatgcctatgcaactgtaattagtggtgctggaccaactattttaatattt
agtcgcaaagaaaatagtggcgaattagttcgcgctttaaatagaaatgtagttacatgt
cattctgaattagtggatattaatgttagtggtgttaaagaacgaattgtataccaatag

DBGET integrated database retrieval system