KEGG   Stigmatella aurantiaca: STAUR_1375
Entry
STAUR_1375        CDS       T01425                                 

Gene name
gacR
Definition
(GenBank) 1-epi-valienol-1,7-bisphosphate-1-adenylyltransferase GacR
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00525  Acarbose and validamycin biosynthesis
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    STAUR_1375 (gacR)
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     STAUR_1375 (gacR)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 DUF4954 Hexapep
Other DBs
NCBI-ProteinID: ADO69179
UniProt: Q09B64
LinkDB
Position
complement(1678766..1679848)
AA seq 360 aa
MNDLRAVLLAGGYGKRMGRLGATRVKPVIPFGTRCHLMDFSLHNAQRSGLDEVLLMSRYN
EQQLHTYLRETWHPRIPIHFGPFNALHQQPAEQVYREVQRADEKGTADALIQNRPYIDTP
PYRHTLVLHSDHVYLFDYRDMYRFHLEQRAALTIGFQQIPLEFVSLFGMVEVDREMNLRA
FVEKPPQPTSDKVFTAVCLFQNEILYRYLDAFQGTSWQHDISRDVIPRMLAQGEVIKCYP
FPDYWEDIGTAHRYHRAHMNLLQGIGVPLEDMPRILPGGELCVLTETDRVRRSIVPTALR
EGPAHIEHSVVFAGATLGEGARIENSVVLPGSRVAAGVHVKNSIVCTDEVIESDFIGRLE
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaatgacctgcgggcagtcctgctggccggcggatacggaaagcgcatggggcggctc
ggggccacccgggtcaagccggtcatcccgtttgggacccgctgccacctgatggacttc
agtctgcacaacgcccagcgctcgggactcgatgaagtcctgctgatgtcccggtacaac
gagcagcagctccacacctatctgcgcgagacgtggcacccccggattcccatccacttc
ggcccgttcaacgccctgcaccagcagcccgccgagcaggtgtaccgcgaggtgcagcgc
gccgacgagaagggcacggcggacgccctcatccaaaaccggccctacatcgacaccccg
ccctaccgccataccctcgtcctgcactcggaccatgtctatctcttcgactaccgggac
atgtaccgcttccacctcgagcagcgcgcggcgctgaccatcgggttccagcagattccc
ctggagttcgtctcgctgttcggcatggtcgaagtcgatcgcgagatgaacctgcgggcc
ttcgtggagaagcccccccagcccacctcggacaaggtgttcaccgcggtgtgcctcttc
cagaacgagatcctctaccgctacctggatgccttccaaggcacgtcctggcagcacgac
atcagccgcgatgtgattccgcggatgctggcccaaggcgaagtcatcaagtgctatccc
ttcccggattactgggaggacattggcacggcgcaccgctatcaccgggcccacatgaac
ttgctgcagggcattggcgttccgttggaagacatgccgcgcatcctgcccggcggcgag
ctgtgcgtgctcacggagacggaccgggtgcgccggtccatcgtgcccacggcactcagg
gaagggcccgcgcacatcgagcactcggtcgtcttcgcaggggccaccctcggcgagggc
gcccgcatcgagaacagcgtcgtcctgcccggcagccgggttgccgccggggtgcatgtg
aagaactccatcgtctgtaccgacgaagtgattgaatcggacttcatcggccgcctggaa
tga

DBGET integrated database retrieval system