KEGG   Stigmatella aurantiaca: STAUR_1378
Entry
STAUR_1378        CDS       T01425                                 

Gene name
gacV
Definition
(GenBank) dTDP-4-keto-6-deoxy-glucose 4-aminotransferase GacV
  KO
K20428  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00525  Acarbose and validamycin biosynthesis
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    STAUR_1378 (gacV)
Enzymes [BR:sur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     STAUR_1378 (gacV)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: ADO69182
UniProt: E3FJ87
LinkDB
Position
complement(1683362..1684654)
AA seq 430 aa
MSTEDILEVERRYLNQGISEEAALGGVAFTHGRGSLLFDAEGKQYLDMSAGIFTQSTGHG
HPHVTSSMHRQLDRLWNVHDFPTDARAALCEKLTQHFPEHLQTFAFFTTGAEAIEAAIRA
VFGAVSPQRQRLAALRYGFHGKTMGARMLVHWDVGTTSFSGNSVLGYPGYCYRCPLGRTY
PSCEMQCAQLVNKHISNKKNIAALFFEPIQGAAGVIVPPLEYWPMIQEECRKSGVLLVAD
EIVTGGGRTGEFLACSLFNVQPDIVAAAKGLSSGFPFSMLAGRKSLLNEGEFAQGGAASS
TFGGNPLSMTAARATLEVLESEHLLDRVKRLGGRLREGLLALKADFPFLGDARGVGLLYA
LEFVTTPQGKEPDAAKARFFFRRCMELGVKTCVGGHIIRIGPPFTVSEQELEQALGVFGQ
VLKQMHDQKV
NT seq 1293 nt   +upstreamnt  +downstreamnt
gtgagcactgaggatatcctggaggtcgagcgccgctacctcaaccaaggcatctccgag
gaggccgcgctgggcggcgtggcgttcacccatggccgcggcagccttctgttcgacgcc
gagggcaagcaatacctggacatgtccgcgggaatcttcacccagtccactgggcatggc
caccctcacgtgaccagcagcatgcaccgccagctggaccgcctgtggaacgtgcacgac
ttccccaccgacgcgcgggccgccctgtgcgagaagctgacgcagcacttcccagagcac
ttgcaaaccttcgccttcttcaccacgggcgccgaggccatcgaggccgcgatccgcgcc
gtgtttggcgcggtgtccccgcagcgccagcgcctggcggccctgcggtacggcttccat
ggaaagaccatgggagcccgcatgctggtgcactgggacgtcggcaccacgtccttctcc
ggcaactcggtcctgggatatccggggtattgctaccgctgcccgctggggcgcacctac
cccagttgcgagatgcagtgcgcccagctcgtgaacaagcacatcagcaacaagaagaac
atcgcggccctgttcttcgagcccatccaaggtgcggcgggcgtcatcgtcccccccttg
gaatactggccgatgatccaggaggagtgccgcaagagtggggtgctgctggtcgcggat
gagatcgtcacggggggtggccggaccggcgagttcctcgcatgctcccttttcaacgtc
cagccggacatcgtcgccgccgccaaggggctctcctcgggcttccccttctccatgctg
gcggggcgcaagtcgctgctgaacgaaggcgagttcgcccaggggggcgccgcctcctcc
acctttggcggcaatcccctgagcatgacggcggcgcgggccaccctcgaagtcctggag
tccgagcacttgctggaccgggtcaagcggctgggaggcaggctgcgcgaggggctgctc
gcgttgaaagcggacttcccgttcctgggagacgcgcgaggtgtggggcttctctatgcc
ctggagttcgtgaccacgccccagggaaaggagccagacgcggccaaggcccggttcttc
ttccgccgctgcatggagctgggggtgaagacgtgcgtggggggccacatcatccggatc
ggtccacccttcacggtgagcgagcaggagctggaacaggcgctcggcgtgttcggccag
gtgctcaagcagatgcatgaccagaaggtatga

DBGET integrated database retrieval system