KEGG   Stigmatella aurantiaca: STAUR_1840Help
Entry
STAUR_1840        CDS       T01425                                 

Definition
(GenBank) Ribonuclease BN-related protein
  KO
K07058  membrane protein
Organism
sur  Stigmatella aurantiaca
Brite
KEGG Orthology (KO) [BR:sur00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    STAUR_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ADO69644
UniProt: Q09CJ4
LinkDB All DBs
Position
2281258..2282181
Genome map
AA seq 307 aa AA seqDB search
MVPLRKDYLLNMEDVPPSQFGKQAFGSGSAAAWKDILGNLRREWKRNKLSDAAAALTFYG
VLSLFPFLLFIVALAGLVIQPEQVQALIGELGREVPPAFSQIPSAQLAQLTSGPSTGLLT
FSALAAVWSAAAGVVSLMTALNTAYGVTESRPRWKVYGIALGMMLGGALLALLAGLVAVA
APALATRLGQPWMALVGWLRLPLAALLMMSLWATLYSVLPDVRQKFKFITPGSVAGVLVW
LAASLGFSFYVSHFSTFGITYGALGGIIVLLLWMWISSLALMLGAEINAVLARRSSEGKS
ETARERA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggttccgctccgcaaggactaccttcttaatatggaagatgtgcccccaagccagttt
ggaaagcaggcgttcggctcgggcagcgccgcggcatggaaggacatccttgggaatttg
agacgggagtggaagcgcaacaagttgagtgacgccgcggccgccctcacgttctatggc
gtcctctccctctttcccttcctgctcttcatcgtcgccctggcggggctcgtcattcaa
cctgagcaggtgcaagcgcttatcggcgagcttgggcgcgaggttcccccggccttcagc
cagatcccctctgcgcaacttgcgcaactcacctctggacccagcacggggttgctcacc
ttcagcgcgctggccgcggtgtggtcggcggccgctggggtggtgagtctcatgacggcc
ctcaacaccgcctacggtgtgacggaaagccgtccgcgctggaaggtgtacgggatcgcc
ctcgggatgatgctggggggggccctcctggcgctgctcgccgggctcgtcgccgtggcg
gcccctgcccttgccacccggctcggacagccctggatggcgctcgtgggctggctgagg
ctgcccctcgcggcgctgctgatgatgagcctctgggcaaccctctactccgtgctcccg
gatgtccggcagaaattcaagttcatcactcccggctccgtggcgggggtgctcgtctgg
ctcgcggcttcgctgggattctccttctacgtctcccacttcagcacgttcggcatcacc
tatggcgccttgggcggaatcatcgtcctgctgctgtggatgtggatctcctcgctcgcg
ctgatgctgggtgccgagatcaacgccgtcttggcgcgccgttcttcggaagggaaatcg
gagacggcgcgcgaaagggcctga

DBGET integrated database retrieval system