KEGG   Stigmatella aurantiaca: STAUR_2267Help
Entry
STAUR_2267        CDS       T01425                                 

Gene name
gatB
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00970  Aminoacyl-tRNA biosynthesis
sur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STAUR_2267 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sur03029]
    STAUR_2267 (gatB)
Enzymes [BR:sur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     STAUR_2267 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     STAUR_2267 (gatB)
Mitochondrial biogenesis [BR:sur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    STAUR_2267 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADO70071
UniProt: E3FDJ2
LinkDB All DBs
Position
2788782..2790227
Genome map
AA seq 481 aa AA seqDB search
MPLNDFQPVIGLEVHAQLLTKSKLFCGCSTEFGAEPNQNTCPVCLAMPGVLPVFNQRVAE
FAIRTGLALGCTIKKTSVWSRKNYFYPDLPKGYQITQYDQPICEWGALTIDTPEGEKTVR
IRRIHMEEDAGKNVHDAAVGESLVDLNRAGVPLLEIVSEPDLRSADEAVEYLKALRDVLV
YLGVNDGNMEEGSFRCDVNVSVMRKGETQYGQRCELKNINSFRFIKQAAEYEISRHVEVL
ESGGKIDQETRLWDTQRGETRSMRSKEDAHDYRYFPEPDLPPLHLADALIDEVAQGLPEL
PRTKFKRFMSQYGIPAYDAKLLCAERPLAEFFEACTQHYKDYKKLSNWFQGELARLLNES
GGTVSISTLKFTPAQFGELLSAVEKGTLSNNAAKDVFAEMFREGKSPEAIIAEKGLAQVS
DAGAVEAVVDDVLAKNAGEAEKYRAGKKQIFGFFVGQVMKAMKGKGNPALVNELLKKKLG
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgaacgatttccagcccgtcatcggcctcgaggtccatgcccagctgttgacg
aagtcgaagctcttctgcggctgctccacggagttcggcgcggagcccaaccagaacacc
tgcccggtgtgccttgcgatgcccggggtgctcccggtgttcaaccagcgcgtggcggag
ttcgccatccgcacggggctggcgctcggctgcaccatcaagaagacgagcgtgtggagc
cggaagaactacttctatccggatcttcccaagggctatcagatcacccagtacgatcag
cccatctgcgagtggggcgcgctcaccatcgacacgcccgaaggcgagaagacggttcgc
atccgccgcatccacatggaggaggacgcgggcaagaacgtgcacgatgccgccgtgggc
gagagcctggtggacctgaaccgggcgggcgttcccttgctggagatcgtcagcgagccg
gacctgcgcagcgcggacgaggcggtggagtacctcaaggccctgcgggacgtgctcgtc
tacctgggggtcaacgacggcaacatggaggagggctccttccgctgcgacgtcaacgtg
tcggtgatgcgcaagggagagacgcagtacggccagcgctgcgagctgaagaacatcaac
tccttccggttcatcaagcaggccgccgagtacgagatctcccggcacgtggaggtgctc
gaatcgggcgggaagatcgatcaggagacgcggctctgggacacgcagcggggcgagacg
cgctcgatgcgctccaaggaagacgcgcacgactaccgctacttcccggagccggacctg
ccgcccctgcacctggcggacgcgctcattgacgaggtggcacaggggttgccggagctg
ccgcgcacgaagttcaagcgcttcatgagccagtacggcatcccggcctacgacgccaag
ctgctgtgcgccgagcgcccgctggcggagttcttcgaggcgtgcacccagcactacaag
gactacaagaagctctccaactggttccagggcgagctggcgcgcctgctgaacgagagc
gggggcaccgtgtccatctccacgctcaagttcacgcccgcgcaattcggcgagctgctg
agcgcggtggagaaggggacgctctcgaacaacgcggccaaggacgtgttcgcggagatg
ttccgggagggcaagtcgccggaggccatcatcgccgagaaggggctggcgcaggtcagc
gacgcgggggcggtggaggcggtggtggacgacgtgctggcgaagaacgcgggcgaggcc
gagaagtaccgcgcgggcaagaagcagatcttcggcttcttcgtgggccaggtgatgaag
gcgatgaagggcaagggcaaccccgccctcgtcaacgagcttctcaagaagaagctcggc
gactga

DBGET integrated database retrieval system