KEGG   Stigmatella aurantiaca: STAUR_2365Help
Entry
STAUR_2365        CDS       T01425                                 

Gene name
amy13I
Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00500  Starch and sucrose metabolism
sur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STAUR_2365 (amy13I)
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STAUR_2365 (amy13I)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADO70169
UniProt: Q08YD2
LinkDB All DBs
Position
complement(2920024..2921289)
Genome map
AA seq 421 aa AA seqDB search
MFKKKVLGGVLFLSWALGLAASPAAFAGPMDGNSGDVMLQGFHWYSYQTSPWWGVIQNKA
SDIGASGFTMVWLPPSSDAASNEGYLPRQLSVQTSRYGNDSQLRSAIGALHTYKVKALAD
IVINHRVGTANWADFTNPTWGSWAVTRGDEWTGATGNADTGDGYGAARDLDHTNATVQGD
LKNWMNGLKSNIGYDGWRYDYVKGFNGSYVGNYNTATVPYFSVGELWTDLNLANPDAHRQ
QIMNWIDATGGKSTAFDFTTKGLLQQAVQYNEFWRLKDSSGKPAGAIGWWAAKSVTFIDN
HDTGPSTPSGGQNHWPFPSDKVMQGYAYILTHPGVPCVYWVHFYDWGLATDIKKLMAIRK
SKGVHSSSAVSIQVADSSRYAALITGTSGTLAMKLGPGDWSPSGSGWTLATSGNNYAVWT
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaagaaggtcctgggtggagtgctgttcctgtcgtgggcgctggggctcgcc
gcgtctccggccgccttcgcggggccgatggatggcaacagcggcgacgtgatgctccag
ggcttccactggtattcctaccagacgtccccctggtggggcgtcatccagaacaaggcc
tccgacatcggcgccagcggcttcaccatggtgtggctgccgcccagcagcgatgcggct
tccaacgaaggctacctgcccagacagctcagcgtgcagaccagccggtacggcaatgac
tcgcagctccggtcggccatcggcgccctgcatacctacaaggtgaaggccctcgccgac
attgtcatcaaccaccgcgtggggaccgccaactgggctgacttcaccaaccccacctgg
ggctcctgggctgtcacgcgaggggatgagtggacgggcgccacgggcaacgccgacacc
ggggatggctatggcgccgcccgcgacctggaccacaccaacgccaccgtccagggcgat
ctcaagaactggatgaacgggctcaagtccaacatcggctatgacggctggcgctatgac
tacgtgaagggcttcaacggctcatacgtcggcaattacaacaccgccaccgtcccctac
ttctccgtgggcgagctgtggacggacctgaacctggccaatcccgacgcccaccgtcag
cagatcatgaattggatcgacgccacgggcggcaagtcgacggcgttcgacttcaccacc
aagggcctcctccagcaggccgtccagtacaacgagttctggcggctgaaggacagctcg
ggcaagcccgccggggccatcggctggtgggcggccaagtcggtgaccttcatcgacaac
catgacactggccccagcaccccgagcggaggccagaaccactggccctttcccagtgac
aaggtcatgcagggctatgcctatatcctgacccacccaggggttccgtgtgtctactgg
gtccacttctatgattggggccttgccacggacatcaaaaagctgatggccatccgcaag
tccaagggggtccactcctcatcggccgtgagcatccaggtggccgacagcagccggtat
gccgccctcatcaccggcaccagcggcaccctggcgatgaagctcggcccgggtgactgg
tcgccctcgggctcgggctggacgctcgccacgtccggcaacaactacgcggtgtggacg
aagtga

DBGET integrated database retrieval system