KEGG   Stigmatella aurantiaca: STAUR_2727Help
Entry
STAUR_2727        CDS       T01425                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00380  Tryptophan metabolism
sur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    STAUR_2727 (kynU)
Enzymes [BR:sur01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     STAUR_2727 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DPRP Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADO70525
UniProt: Q08XL9
LinkDB All DBs
Position
3310782..3312065
Genome map
AA seq 427 aa AA seqDB search
MTEASMRFEEGEGFARRMDAEDPLRSFREEFLFPQSPQGEPLVYLAGNSLGLQPRRAQQY
VQEEMEDWARLGVEGHFHARRPWLPYHENLTGQTARLVGALPLEVVVMNTLSVNLHLMMV
SFYRPTRERFKILIEGGAFPSDQYAVASQARFHGFDPKDAVLKLEPRAGEDTLRTEDILE
TLERHGSEIALVLLGNVNYLTGQAFDMKALTQAAHARGCRVGFDLAHGAGNLRLSLHDDG
PDFAVWCSYKYLNGGPGALGGVFIHERHARAEGLPRFEGWWGNDKAIRFQMGPDFVPLPG
AEGWQLSNPPIFQLAALRASMELFDRATMPSLRGKGDRLTGYLEFLLDRLPSGFVRITTP
RDVKARGSQLSLRFSKDPRRLLTRLSEAGVCCDFRSPDIIRAAPAPLYNSFQDVYRFVKV
LESHARD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggcttcgatgcgtttcgaggaaggggaggggttcgcacggaggatggacgcg
gaagatccgctgcgctccttccgggaggagttcctctttccgcaaagcccccagggcgag
ccgctggtctacctcgcgggcaactccctggggcttcagcctcgccgggcacagcagtac
gtccaggaggagatggaggactgggcccggctgggcgtggagggccacttccatgcccgg
cgcccctggctgccgtaccacgagaacctgactgggcagacagcacgcttggtgggggcg
ttgccgctcgaagtcgtggtgatgaataccctctcggtgaacctgcacctgatgatggtg
tcgttctaccggcctacccgcgagcgcttcaaaattctcattgaaggaggagcgttccct
tcggaccagtacgcggtggcgtcgcaggcgcgcttccacggcttcgatccgaaggacgcc
gtgctgaagctggagccgcgggccggtgaggacacactgcgcaccgaggacatcctcgag
acgctggagcggcacgggtccgagatcgccctggtgctgctcggcaacgtgaactacctc
acggggcaggccttcgacatgaaggccctcacccaggccgcgcacgcgcgtggctgccgg
gttgggttcgatctggcgcatggtgcgggcaacctgcggctctcgctgcacgacgatggg
cccgacttcgccgtgtggtgctcgtacaagtacctcaatggagggcccggcgcgctgggc
ggcgtcttcatccacgagcggcatgcccgggcggagggacttccgcgcttcgagggttgg
tggggcaacgacaaagccatccgcttccagatggggcctgacttcgtcccactgccggga
gcagagggatggcagctctccaatccgcccatctttcagctcgcggccctgagggcgtcg
atggagctgttcgaccgggccaccatgcccagcttgcgcggcaagggagaccggctcacc
ggctatctggagttcctgctcgaccggcttccctcaggcttcgtgcgcatcaccacccct
cgggacgtgaaggcgaggggctcgcagctctcgttgcgcttctcgaaggatccgcggcgc
ttgctgacgcggctctccgaggcgggcgtctgctgtgatttccgatcgcccgacatcatc
cgcgccgcgcccgcgccgctgtacaactcctttcaggatgtctaccgcttcgtgaaggtg
ctggagagccatgcccgagattga

DBGET integrated database retrieval system