KEGG   Stigmatella aurantiaca: STAUR_3141
Entry
STAUR_3141        CDS       T01425                                 

Definition
(GenBank) 1-epi-valienol-1,7-bisphosphate-1-adenylyltransferase GacR
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00525  Acarbose and validamycin biosynthesis
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    STAUR_3141
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     STAUR_3141
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: ADO70933
UniProt: E3FTY1
LinkDB
Position
3782217..3783308
AA seq 363 aa
MEHVRAVLLAGGRGVRMGRLGQGRLKPLVPFGGQCHLIDFSLLNCRASGIEEVLLLSQHN
EAQLIHYLLAHWHGQGLKIHFGPYQGITPETCEHVLATVHRPAEAGTGDALRLNAPYLFG
NGVRDVLVLHADHVYRFDYRPMLALHRERRAVLTLGYQRIAREAVSLFGMVELGAEDRLL
RFVEKPEQPTADTVFTAVAIFSAEPLQQYLETLSRGPWQADISRDVIPAMIQAGERIFGY
RFEAYWEDIGTSARYLEAHRRLVSDRPTLSLAQLPHTLQSTSARHWVRHAGGLRHTLTGD
DVRCEGRAERSVLFPGVVIGPRAAVRDSVVLPGAHILGDSQVEGSIVLDGEHLRDAHLRD
RTE
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggagcacgtgcgagcggtgttactggccggcgggcgaggcgttcgcatgggccgtctc
gggcaggggcggctcaagccgctggtcccgttcggaggccagtgccacctgatcgacttc
agcctcttgaattgccgtgcctcgggcatcgaggaggtgctgctgctgtctcagcacaac
gaggcacagctgattcattacttgctggcgcactggcacggccaagggttgaagattcac
tttggcccgtatcaaggcatcaccccggagacctgtgaacacgtgctggccacggtgcac
cggccggccgaggccgggacgggcgatgccttgcggctcaatgcgccctatctctttgga
aacggcgtgcgggatgtgctcgtgctccatgccgatcatgtctatcgtttcgactaccgg
ccgatgctggcgttgcaccgcgagcgccgcgcggtcttgaccctggggtatcagcgcatc
gcacgcgaagccgtgtctctgtttgggatggtggagcttggcgcggaagacagactcctg
cgcttcgtcgagaagccggagcaacccacggccgatacagtgttcaccgcggtggccatc
ttctccgcggagccgttgcaacagtatttggaaacactgtcccgggggccctggcaggcc
gacatcagccgggatgtcatccccgccatgattcaggccggggagcgcatcttcggctac
cggttcgaggcgtactgggaagacattggaacctcggcgcgctacctggaggcccaccgg
cgtctcgtgtcggatcggcccacgctgagcctcgcgcagttgccgcacacgctccagtcc
acgtccgcgcgccactgggtgcgccacgccggtgggctgcgccacacgctcaccggggac
gatgtgcggtgtgagggccgggccgagcgctcggtgctgtttccaggcgtggtcatcggt
ccgcgcgcggccgtgcgcgacagcgtcgtgttgcccggggcgcacatcctcggggacagc
caggtcgagggcagcatcgtgctggacggggagcacctgcgcgacgctcacctccgggac
agaacggaatga

DBGET integrated database retrieval system