KEGG   Stigmatella aurantiaca: STAUR_3537Help
Entry
STAUR_3537        CDS       T01425                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00250  Alanine, aspartate and glutamate metabolism
sur00410  beta-Alanine metabolism
sur00640  Propanoate metabolism
sur00650  Butanoate metabolism
sur01100  Metabolic pathways
sur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STAUR_3537 (gabT)
   00650 Butanoate metabolism
    STAUR_3537 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STAUR_3537 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STAUR_3537 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sur01007]
    STAUR_3537 (gabT)
Enzymes [BR:sur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     STAUR_3537 (gabT)
Amino acid related enzymes [BR:sur01007]
 Aminotransferase (transaminase)
  Class III
   STAUR_3537 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADO71327
UniProt: Q094Z5
LinkDB All DBs
Position
4258475..4259746
Genome map
AA seq 423 aa AA seqDB search
MSDNNVNLLRRKDAATPRGVGVMAPFFVSRAENSELWDVEGRRFIDFAGGIAVLNTGHRH
PRVVEAVKAQLDAFTHSAYQIVPYEAYVRLAERLNRLTPGAFAKKTTFFSTGAEAIENAV
KIARSATGRSGIIAFSGGFHGRTMMGLALTGKVVPYKAGFGPFPPEVYHVPFPIALHGIS
VEDTLRAFQNLFKADIEPKRVAAILIEPVQGEGGFYVAPPELMRSLRKLCDEHGILLIAD
EVQTGFARTGKWFAMDHHDVHPDLIVTAKSLAGGFPLSAVTGRAEVMDAPEPGGLGGTYA
GNPLAIAAANAVLDIIEDEGLVKRANELGDVLRIKLEGLKAKVPQMAEVRGLGAMLAVEF
CQPGGHTPDTEFTKVVKARALEKGLMLLTCGVYSNVIRFLFPLTVPEPVFKEGLSILESA
LTG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaacaacgtcaacctgctgcgccgcaaggatgccgccacaccgcgaggggtg
ggggtgatggcgccttttttcgtctcccgcgcggagaacagtgagttgtgggacgtggag
ggccgccgcttcatcgacttcgcgggcggcatcgcggtgctcaacacggggcatcgccac
cctcgggtggtcgaggcggtgaaggcccagctcgatgccttcacgcacagcgcctaccag
atcgtcccctacgaggcctacgtgcggctggccgagcggctcaaccggttgacgccgggg
gcgttcgccaagaagacgaccttcttctccacgggggccgaggccatcgagaacgcggtg
aagatcgcccgttcggccacgggccgcagcggcatcatcgccttcagcggggggttccac
ggccggacgatgatgggcctggcgctcaccggaaaggtggtgccgtacaaggcaggcttc
gggccttttccgccggaggtctaccatgtgccctttccgatcgccctgcacggcatcagc
gtggaggacacgctccgggcgtttcagaacctcttcaaggcggacatcgagcccaagcgg
gtggcggccatcctcatcgagccggtgcagggagagggcggcttctacgtggcgcccccc
gagctgatgcggagcctgagaaagctgtgcgacgagcacggcatcctgctcattgccgat
gaggtgcagaccggcttcgcgcgcacggggaagtggttcgcgatggaccaccacgatgtg
catccggacctgatcgtgacggccaaatccctggcgggagggttccccctgtcggcggtg
acgggccgggcggaggtgatggatgcaccggagccaggtgggctcggaggcacctacgcg
ggcaaccccctggcgatcgcggcggcgaacgcggtgctggacatcatcgaggacgaaggc
ttggtgaaacgggccaacgaactgggggacgtcctgcgcatcaagctggaggggttgaag
gcgaaggtgccccagatggcggaagtgcgggggctgggggccatgctggcggtggagttc
tgccagccgggcggccatacgcctgacacggagttcaccaaggtggtgaaggccagggcc
ttggagaaggggctgatgctgctgacgtgcggcgtctactccaacgtcatccgcttcctc
ttcccactgacggtgcccgagccggtgttcaaggaggggctgtccatcctggagtccgcg
ctgacggggtag

DBGET integrated database retrieval system