KEGG   Stigmatella aurantiaca: STAUR_4052Help
Entry
STAUR_4052        CDS       T01425                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00020  Citrate cycle (TCA cycle)
sur00190  Oxidative phosphorylation
sur00650  Butanoate metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
Module
sur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STAUR_4052 (sdhA)
   00650 Butanoate metabolism
    STAUR_4052 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    STAUR_4052 (sdhA)
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     STAUR_4052 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     STAUR_4052 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 NAD_binding_8 HI0933_like FAD_binding_3 GIDA DAO
Motif
Other DBs
NCBI-ProteinID: ADO71838
UniProt: Q08WU1
LinkDB All DBs
Position
4909476..4911353
Genome map
AA seq 625 aa AA seqDB search
MAAAARFTVVGGGLAGLMTTIKLAEAGHQVDVLSVVPVKRSHSVCAQGGINGAVNTKGEG
DHPDIHVMDTLRGGDFLAEQVSVKGMCYAAPGVIYMLDRMGVTFNRTSEGLLDFRRFGGT
LHHRTAFAGATTGQQLLYALDEQVRRYEAEGKVTKYEFWEWLGTVKDESGRCIGSVALDL
RTMEIRTFPAEAVCLATGGPGIVFGRSTNSIINTGTAAGRAYLEGAIYANGEFIQVHPTS
IPGEDKLRLMSESVRGEGGRVWVPRKKADPRSPKDIPESERWYFLEEKYPKYKNLVPRDV
ATREIFTVCRDLGLGIGGRDGVYLDVTHIPAKTLDAKIKGVMEIYEKFVGDDPRNTPMVI
FPGMHYSMGGLYVSFEADPRTLTPAEGSPKNQATNIPGLYAAGEADYAFHGANRLGANSL
LSCIYSGMIGGPAMAAYAKNNAQSAAAKSDKYFNDAKKYWDERFADLKKMSGPENPYQIA
KELGDVMTENCTVVRYNDRLKKTIEKVRELKDRWKNVNVLDTGNVANRSLSYTNQVWNML
ELGEVIATSALLRDESRGAHYKPDFSLPEPKTKDPREDAGWMELWKKRHEKWAKTTMAKH
APEGPQISYEDVPTPVLAPEPRWYA
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcagcgcggttcacggtggtcggcggcggcctcgccggactgatgacgacg
atcaagctggccgaggcgggacatcaggtcgatgtgctctccgtggtgccggtgaagcgc
tcgcactcggtctgcgcccagggcggcatcaacggtgcggtgaacacgaagggcgagggg
gaccacccggacatccacgtgatggacacgctgcggggcggcgacttcctcgccgagcag
gtgtccgtcaagggcatgtgctacgcggccccgggcgtcatctacatgctggaccgcatg
ggggtgacgttcaatcgcacctccgagggcctgctggacttccggcgcttcggcggcacg
ctccaccaccggacggcgttcgcgggcgccaccaccggccagcagctgctctacgcgctg
gatgagcaggtgcgccgctacgaggccgagggcaaggtcaccaagtacgagttctgggag
tggctcggcacggtgaaggacgagtccggccggtgcatcggcagcgtggcgctggatctg
cggacgatggagatccgcaccttcccggcggaggccgtgtgcctggccaccggtggcccg
ggcatcgtgttcgggcgctccaccaactccatcatcaacacgggcaccgccgcgggccgc
gcgtacctggaaggcgccatctacgccaacggcgagttcatccaggtgcaccccacctcc
atcccgggcgaggacaagctgcgcctgatgagcgagtcggtccgtggcgagggcggccgc
gtctgggtgccgcgcaagaaggccgacccgcgcagcccgaaggacatccccgagagcgag
cgctggtacttcctcgaggagaagtaccccaagtacaagaacctggtgccgcgcgacgtg
gccacgcgcgagatcttcacggtctgccgcgacctgggcctgggcatcggcggccgcgac
ggcgtgtacctggacgtgacgcacatccccgccaagacgctcgatgcgaagatcaagggc
gtgatggagatctacgagaagttcgtgggggatgacccgcgcaacacgcccatggtcatc
ttcccgggcatgcactactccatgggcggcttgtacgtgtccttcgaggccgacccgcgc
acgctcaccccggccgagggcagcccgaagaaccaggccaccaacatcccgggcctctac
gccgcgggcgaggcggactacgccttccatggcgccaaccggttgggcgccaactcgctc
ctgtcctgcatctactcgggaatgattggcggccccgcgatggccgcctacgccaagaac
aacgcccagagcgccgccgccaagagcgacaagtacttcaacgacgcgaagaagtactgg
gacgagcgcttcgcggacctcaagaagatgtccggccccgagaacccgtaccagatcgcc
aaggagctgggcgatgtgatgacggagaactgcaccgtcgtgcgctacaacgaccggctc
aagaagacgatcgagaaggtccgcgagctgaaggaccgctggaagaacgtcaacgtgctg
gacacgggcaacgtggccaaccggtcgctgtcctacaccaaccaggtgtggaacatgctg
gagctgggcgaggtgatcgccaccagcgcgctgctgcgcgacgagagccggggcgcccac
tacaagccggacttctccctgcccgagcccaagacgaaggacccgcgcgaggacgccggg
tggatggagctctggaagaagcgtcacgagaagtgggcgaagacgaccatggcgaagcac
gcgcccgaggggccgcagatctcctacgaggacgtcccgacgcccgttctggctccggaa
ccgcgctggtacgcgtaa

DBGET integrated database retrieval system