KEGG   Stigmatella aurantiaca: STAUR_4053Help
Entry
STAUR_4053        CDS       T01425                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00020  Citrate cycle (TCA cycle)
sur00190  Oxidative phosphorylation
sur00650  Butanoate metabolism
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
Module
sur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STAUR_4053 (sdhB)
   00650 Butanoate metabolism
    STAUR_4053 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    STAUR_4053 (sdhB)
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     STAUR_4053 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     STAUR_4053 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_17 Fer4_16 Fer4 Fer4_2 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ADO71839
UniProt: Q08WU0
LinkDB All DBs
Position
4911381..4912187
Genome map
AA seq 268 aa AA seqDB search
MDTAQPSSVSSQTITFRIWRQDGPGGESHYDEFRIPYHKGANVVSCLMEIQRNPVTVQGK
KVAPVVWDAACLEEVCGSCAMNINGRVRMACSALIDKLEQPITLEPLKKFPVIRDLTVNR
DRMFEALKRVKAWIPVDGTHNLGPGPRQSPKDHATMYVLSTCITCGSCLEACPQVTLDNH
FVGAAAISQARLFNMNPTGKLNAEERTRALMGPGGVQDCGKAQNCVKVCPKEIPLTSSIA
AMNREVTKLVIKDLFFKDEESKGHSGPG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcacagccgagttccgtctcctcccagaccatcaccttccgcatctggcgg
caggatgggcccgggggcgagagccactacgacgagttccgcatcccgtaccacaagggt
gccaatgtcgtttcttgcctgatggagatccagcgcaaccccgtcaccgtgcagggcaag
aaggtggccccggtggtgtgggacgccgcgtgcctcgaggaggtctgcggcagctgcgcc
atgaacatcaatggccgggtgcgcatggcctgctcggcgctcatcgacaagctggagcag
cccatcaccctggagccgttgaagaagttccccgtcatccgcgacctgacggtgaaccgc
gaccggatgttcgaggcgctcaagcgggtgaaggcgtggatccccgtggacggcacccac
aacctggggccgggcccgcgccagtcgcccaaggatcacgccacgatgtacgtgctctcc
acgtgcatcacctgcggcagctgcctggaggcgtgcccgcaggtcaccctggacaaccac
ttcgtcggcgcggcggcgatcagccaggcgcggctcttcaacatgaaccccaccggcaag
ctgaacgccgaggagcgcacccgcgcgctcatggggccaggcggtgtgcaggactgtggc
aaggcgcagaactgcgtgaaggtgtgtccgaaggagatcccgctgaccagctccatcgcg
gcgatgaaccgcgaggtgaccaagctcgtcatcaaggatctcttcttcaaggatgaagag
agcaaggggcactctggtccaggctga

DBGET integrated database retrieval system