KEGG   Stigmatella aurantiaca: STAUR_5575Help
Entry
STAUR_5575        CDS       T01425                                 

Gene name
fabZ
Definition
(GenBank) Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00061  Fatty acid biosynthesis
sur00780  Biotin metabolism
sur01100  Metabolic pathways
sur01212  Fatty acid metabolism
Module
sur_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    STAUR_5575 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    STAUR_5575 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sur01004]
    STAUR_5575 (fabZ)
Enzymes [BR:sur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     STAUR_5575 (fabZ)
Lipid biosynthesis proteins [BR:sur01004]
 Fatty acid synthase
  Component type
   STAUR_5575 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ADO73340
UniProt: Q08WQ2
LinkDB All DBs
Position
complement(6891129..6891590)
Genome map
AA seq 153 aa AA seqDB search
MDIGEIQRLLPHRYPFLLVDRVVEFVEGQKLTAYKNVTINEPFFNGHFPGHPVMPGVLIL
EALAQATAILAYKSESMNPENKVAYLMGVDNAKFRKPVLPGDRLELGIEVLRHKGSVWKT
KGTATVDGVKVAEGEFLATVVDKDARTAAEPAP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggacattggagagatccagaggctgctgccccatcgctacccgtttctgctggtagac
cgggtggtggagttcgtcgagggccagaagctcacggcctacaagaacgtcaccatcaat
gagccctttttcaacggccacttcccgggacacccggtgatgccaggggtgctcatcctg
gaggcgctggcgcaagccacggccatcctggcctacaagagcgagagcatgaacccggag
aacaaggttgcctacttgatgggggtagacaacgcgaagttccgcaagccggtgcttccc
ggggatcggttggaactgggcattgaagtgctgcgccacaagggctctgtctggaagacg
aaggggacggccacggtggacggcgtgaaggtcgcggaaggcgagttcctggccacggtg
gtggacaaggatgcgaggaccgcggcggagccggcgccctag

DBGET integrated database retrieval system