KEGG   Stigmatella aurantiaca: STAUR_6602Help
Entry
STAUR_6602        CDS       T01425                                 

Definition
(GenBank) Manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sur  Stigmatella aurantiaca
Brite
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     STAUR_6602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADO74359
UniProt: Q09C50
LinkDB All DBs
Position
8087303..8087902
Genome map
AA seq 199 aa AA seqDB search
MVDKKYTPLKFPELKGLKGISDAVLETHFKLYEGYVNRANKLTESLSGLATQGEASGTNP
VYAELTRRLGFEYNGMVLHEYYFGNLKPGGTPPGDRLKKAFEASFGSFENWLTDFKAVAT
MPGIGWAVTFQDPRNGWLSNHWITLHETNNIAGFTPIIVLDAWEHAFVPDYKANERAKYV
DAYFSNIDYEAAQARLNVK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtcgataagaagtacacgccgctcaagttcccggagctcaagggcctcaagggcatc
agcgatgcggtcctcgaaacgcacttcaagctgtacgagggctatgtcaaccgcgccaac
aagctcaccgagagcctgtcgggtctggccacccagggcgaagcctccggaaccaacccc
gtctacgcggagctgacgcgtcgcctgggcttcgaatacaacggcatggtccttcacgag
tactacttcggcaacctgaagccgggcggtaccccgccgggtgaccggctgaagaaggcg
ttcgaggcaagcttcggctccttcgagaactggctgacggacttcaaggccgtggccacc
atgccgggcatcggctgggccgtcaccttccaggatccgcgcaacgggtggctgtccaac
cattggatcaccctgcacgagaccaacaacatcgcgggcttcacgcccatcatcgtcctg
gacgcgtgggagcacgccttcgtcccggactacaaggccaacgagcgcgccaagtacgtg
gatgcgtacttctccaacatcgattacgaggccgcccaggcgcggctgaacgtgaagtag

DBGET integrated database retrieval system